KEGG   Enterococcus hirae: EHR_05660Help
Entry
EHR_05660         CDS       T02160                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ehr  Enterococcus hirae
Pathway
ehr00230  Purine metabolism
ehr01100  Metabolic pathways
Module
ehr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EHR_05660 (gmk)
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EHR_05660 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_16 RsgA_GTPase MMR_HSR1 AAA ABC_tran
Motif
Other DBs
NCBI-ProteinID: AFM70083
UniProt: I6SBT9
Position
1083919..1084533
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFESEDNDFQYSISMTTRKMREGEVEGVDYYFRSKE
EFEAMIEAGEMLEYAEYVGNYYGTPLSYVNKTLDEGKDVFLEIEVQGAQQVKEKVPDGVF
IFLTPPDLAELKSRIVGRGTDADEVIEERMKVAKEEIEMMALYDYAVVNDQVPLAVERIK
NIIASEHFRVDRVIGKYIKMLKEM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgtggattattaatcgtgttgtctggaccatcaggtgtaggaaaaggcaca
gtgcgaaaagcaatttttgagagtgaggataatgatttccaatattcgatttcaatgact
actcgtaagatgcgtgaaggagaagtcgaaggagtcgattactactttagaagcaaagaa
gaattcgaagcaatgatcgaagccggagaaatgctggaatatgctgaatatgtagggaat
tattatggaacacctttgtcttatgtcaataaaacattggacgaaggaaaagatgtattt
ttagaaatcgaagtccaaggtgctcaacaagtcaaagaaaaagtaccagatggcgtattt
atcttcctaactcctcccgatttagccgaattaaaatcaagaatcgttggccgtgggaca
gatgcagatgaagtaatcgaagaacgaatgaaagttgccaaagaagaaattgaaatgatg
gcactatatgattatgccgtagtcaatgaccaggtacccctggcggtagaacgaatcaaa
aatatcattgccagtgaacactttcgtgtcgaccgtgtgatcggcaaatatatcaaaatg
ttaaaggagatgtag

DBGET integrated database retrieval system