KEGG   Enterococcus hirae: EHR_06485Help
Entry
EHR_06485         CDS       T02160                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_06485
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EHR_06485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275036..1276481
Genome map
AA seq 481 aa AA seqDB search
MFKEYKMPKDFLWGGAIAANQAEGAYQVDGKGISLADLHVFHADKTNAEIAEEQHKGMSL
AQLKANMTDEQGYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSIDWSRIFPTGDETEPN
EAGLAYYDALIDKIRELGMEPIITMLHYETPVDITLNYGGWHNRKVIDLFVKYGKTILDR
YKDKVKYWIVINQINLIQFEPFNSTAIPYDTVDHYEEASYQAIHNQFVASAKIYEYGKKL
NPEMQIGTMVADCTAYPFSCDPDDIILALRRNRMEYFYTDVQFRGEYPQYALNYFAENNI
HLEITEEDKAILQANTMDYLAISYYYSQMVDSKKNDMNPASVTPNPNLKANPWGWAVDPK
GLYHSLSQYWDRYGKAIIIAENGFGMYDQLENGKIHDDYRIDYLASHIEEMKRAMYDGVN
VIAYCAWGPIDIISCSSAQMEKRYGFIYVDLDNEGKGSGDRIKKDSFYWYKNVIESNGEN
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaatacaaaatgccaaaagattttctttggggaggggcgattgctgccaac
caagcagaaggggcttatcaagttgatggtaagggcatcagcctcgctgatttacatgtt
ttccatgcggataaaacaaatgcagaaattgcggaagagcaacataaaggaatgtctttg
gctcagttgaaggcgaatatgacagatgaacaaggctattatcctaaacgccatgggatc
gatttttatcatacctatcctgaagatttagcgctattagcagagatgggctttaaaacg
tttcggacgtcgattgattggtcgaggatttttcctacgggcgatgaaacggaaccgaat
gaagcgggtttggcttattatgatgcgttgattgataagatccgtgagttagggatggag
ccgattattacgatgcttcattatgaaacaccggtagacattactttaaactacgggggt
tggcataatcggaaagtgatcgatctatttgtaaaatatggaaaaacaattttagatcgt
tacaaagataaagtgaagtattggatcgtcatcaatcagatcaacttgatccaatttgaa
ccattcaattcaactgctattccttatgatacggtggatcattacgaagaagctagctat
caagcgatccataatcagttcgttgccagtgctaaaatctatgaatatgggaaaaagctc
aaccctgaaatgcaaattggaacgatggttgcagattgcaccgcctatccattttcttgc
gatccagatgatatcattttggctttacgtcgtaatcggatggagtatttctatacagat
gtgcaatttcgaggggaatatcctcagtatgcgttgaattattttgctgaaaataatatc
catctcgagatcactgaagaagacaaagccattttacaagcgaatacgatggattatctg
gctatttcttattattattcgcaaatggtcgactccaagaaaaacgatatgaaccctgca
tcggtgacacctaacccgaacttgaaagctaatccatgggggtgggcagtggatcctaaa
gggttgtatcattcactgtcgcaatattgggatcgttatggtaaagcgattattattgca
gaaaatggctttggaatgtacgaccagttggaaaacggcaagattcatgatgattatcgg
atcgattatctggctagtcacattgaagaaatgaaacgtgcgatgtatgatggagtcaat
gtgattgcttattgtgcatgggggccgattgacattatcagctgttcatctgctcaaatg
gaaaaacgttatggatttatctatgtggatctggataatgaaggaaaaggtagtggtgat
cggatcaaaaaagatagtttttactggtacaaaaatgtgattgaatcgaatggagaaaat
ttgtaa

DBGET integrated database retrieval system