KEGG   Enterococcus hirae: EHR_07210Help
Entry
EHR_07210         CDS       T02160                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_07210
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EHR_07210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1426510..1427946
Genome map
AA seq 478 aa AA seqDB search
MEHQKLTEFPQDFLWGSASAAYQVEGAWQEDGKGESVWDRFVRIPGKTFKGTNGDLAVDH
YHRFKEDIALMKEQGLKAYRFSVAWTRIFPNGRGEINQAGLAFYEELIDELIENGIEPML
TLYHWDLPQALQDEYAGWESRQIIEDFTNYAETLFNAFRGKVHYWISLNEQNIFTSLGYL
LAAHPPGVTDPKRMYQVNHIANLANATVINKFHELGMPGKIGPSFAYTPNYPINSDPKNI
LAAENAEDLMAHYWMDVYMWGKYPIAAMKFLEERGWAPEMVEGDAELLESAKPDFLGINY
YQTATNAFNPLDGVGAGKMNTTGKKGSSEETGVPGMYKKVDNPFVERTNWDWEIDPEGLR
IALRRITSRYRMPVLITENGLGEYDELTEDKKIHDEYRIAYLSSHVKAIKEAISDGAEVL
GYCTWSYTDLLSWLNGYQKRYGFVYVDQDETQAGSLDRYKKDSYYWYQQVIKENGSTI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccaaaaattaactgaatttccccaagattttctttggggatcagcctcagcg
gcttatcaagttgaaggagcctggcaagaagacggcaaaggagaatcggtctgggatcgt
tttgtccgtattccagggaaaacttttaaaggaacaaacggcgatctagcggttgatcac
tatcatcgctttaaagaagatattgctttaatgaaagaacaaggattgaaagcgtatcgt
ttttcagttgcttggactcgcatttttcctaatggtcgtggggaaatcaatcaagcaggg
ttagctttttatgaagagctgatcgacgagttgattgaaaacgggattgaaccaatgttg
acattgtatcattgggatcttccacaagccttgcaagatgagtatgcaggttgggaatca
cgccaaatcattgaagatttcactaattatgctgaaacattatttaatgcttttcgagga
aaagtccattattggatcagcttgaatgaacaaaatatttttacttcactaggctattta
ttagctgctcatccaccaggtgttactgatccgaaacggatgtatcaagtgaaccatatt
gctaacttagcaaatgcaacagtgatcaataagtttcatgaattaggaatgccaggtaaa
atcggtccaagttttgcttacacacctaattatccaatcaacagcgatcctaaaaatatt
ttagctgcagaaaatgcggaagatttgatggctcattactggatggatgtctacatgtgg
ggcaagtacccgatcgccgctatgaaatttttagaagaacgtggctgggcacctgaaatg
gttgaaggagacgcagaactgcttgaatctgctaaaccagacttcttggggatcaactat
tatcaaacagctactaatgcctttaatccgttggatggtgtaggagctggaaaaatgaat
accactgggaaaaaaggatcttctgaagaaacaggcgtcccaggaatgtacaaaaaagtc
gacaatcctttcgttgaacgtacgaattgggattgggagatcgacccagaaggattgaga
atcgcattaagacggattacgagtcgctaccgaatgcctgtattgattactgaaaatggt
ttaggggaatacgatgaattgacagaggacaaaaagatccacgatgagtatcgtatcgct
tacctttcaagtcatgtcaaagcgattaaagaagcgatctcagatggtgctgaagtcctt
ggttattgtacttggtcttacactgatctgttaagttggttgaatggctaccaaaaacgt
tatggatttgtttatgtcgatcaagatgaaactcaagcaggatcattggatcgctacaag
aaagatagttactattggtaccaacaagtgatcaaagaaaatggctcaacgatctga

DBGET integrated database retrieval system