KEGG   Enterococcus hirae: EHR_08400Help
Entry
EHR_08400         CDS       T02160                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_08400 (tpiA)
   01230 Biosynthesis of amino acids
    EHR_08400 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_08400 (tpiA)
   00051 Fructose and mannose metabolism
    EHR_08400 (tpiA)
   00562 Inositol phosphate metabolism
    EHR_08400 (tpiA)
Enzymes [BR:ehr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EHR_08400 (tpiA)
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EHR_08400 (tpiA)
  Exosomal proteins of bladder cancer cells
   EHR_08400 (tpiA)
  Exosomal proteins of melanoma cells
   EHR_08400 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663795..1664550
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTASEAKEFAEAVKNNIPSNEKVDSVIGSPALFLQELMASAEGTELK
ISAQNCYWENSGAFTGETSPAALADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANG
MIPILCCGESLETYEAGKTAEWIEGQITAGLEGLTDGQVSNMVIAYEPIWAIGTGKSADA
QIADEICGVVRQTVEKLYGKEVSDAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgctggtaactggaaaatgaacaaaactgcatctgaagcaaaa
gaatttgctgaagcagtaaaaaacaacatcccttcaaatgaaaaagttgattctgttatc
ggatcacctgctttgttcttacaagaactaatggcttcagctgaaggaacagaattaaaa
atctcagcacaaaactgctactgggaaaactcaggtgcattcacaggtgaaacttcacca
gctgctttagcagacttaggtgtggactatgtgatcatcggacattcagaacgtcgtgaa
tacttccatgaaacagatgaagacatcaacaaaaaagcgaaagctatctttgcaaacggc
atgatcccaattctttgctgtggtgaatctttagaaacttacgaagctggaaaaacagct
gaatggatcgaaggacaaatcactgctggtcttgaaggattgacagatggccaagtaagc
aacatggttattgcttacgaaccaatttgggcaatcggtactggtaaatcagctgatgca
caaattgctgacgaaatctgtggcgttgtacgtcaaacagttgaaaaattatacggcaag
gaagtatctgatgcagtacgtatccaatacggtggttctgtaaaaccagaaaacattgct
gaatatatggcgaaagaaaatgttgacggagcattagttggtggcgcaagcttacaagct
gattcattcttagcattattagacgctgtaaaataa

DBGET integrated database retrieval system