KEGG   Enterococcus hirae: EHR_08425Help
Entry
EHR_08425         CDS       T02160                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ehr  Enterococcus hirae
Pathway
ehr00300  Lysine biosynthesis
ehr01100  Metabolic pathways
ehr01120  Microbial metabolism in diverse environments
ehr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EHR_08425
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EHR_08425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AFM70610
UniProt: I6S1R9
Position
1667424..1668560
Genome map
AA seq 378 aa AA seqDB search
MGNEEKIAILQELIRIKSVNGNEGEVAAYLNQLLNQHGIQGEIISHTEGRDNLVATYHNG
QGRVLGLSGHMDVVSAGDESNWTYPPFAAEIKGNRLYGRGATDMKSGLAAMVIAMIELKE
SGKPFNGTIKLLATVGEEVGELGSEQLTKAGYVDDLDGLIIGEPTNYHLMYTHMGSINYT
VVSHGKEAHSSMPQEGYNAINHLNEFITRANEQMDALANDFQNSALGKTIHNVTVINGGN
QVNSIPSQAQLQGNIRSIPEFPNDQIIDLLQKIVDELNEGTNYHLELTIDYNKIPVKANP
DSSLIHHIQKQFKQPLPLVGAAATTDAAEFTKSAHSFDFVVFGPGVVNLPHQIDEYVEID
NYLDMIDTYQAIILSYLA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagaaaaaatagctattttacaagaactgatccgaatcaagtcagtgaat
gggaacgaaggggaagtagccgcctacttaaatcaattattgaatcaacatggaatccaa
ggagaaatcatttctcacactgaggggcgtgataacttggtggcgacgtatcacaatggt
caaggaagagtattaggtttgtctggtcacatggatgttgtgtctgcaggagacgaatcg
aattggacctatccgccttttgcagcagaaataaaaggcaatcgtttgtatggtcgtggt
gctaccgatatgaaaagcgggctagccgctatggtgattgcgatgattgaattgaaagag
tctggcaaaccgtttaatgggacaatcaaattattagcgacagtaggggaagaagtcgga
gaattaggtagtgaacaactgacaaaagcaggttatgtcgacgatttagacggactgatc
attggggaacctaccaattaccatttgatgtatactcacatgggttcaattaactatacc
gttgtttctcatggtaaagaagctcacagctcaatgcctcaagaaggctacaatgcgatc
aaccatttaaatgaatttattacgcgtgcaaacgagcaaatggatgctttagcgaatgat
ttccaaaattcagcgttaggaaaaacgattcataacgttacagtgatcaacggaggaaat
caagtcaacagtattccaagtcaggcgcaattacaaggaaatatccgctcaatccctgaa
tttccaaacgatcaaatcattgatttattgcaaaagatcgtggatgaattgaatgaagga
acgaactatcacttagaattgacgatcgactacaataagattcctgtgaaagcaaatcct
gattcttcgttgatccaccatattcaaaaacagttcaagcaaccattgcccctagtaggt
gcagcagcaacgacagatgcagctgaatttactaaatccgctcactccttcgattttgtg
gtattcggtcccggagtcgtaaacttgcctcatcaaatagacgaatatgtagaaatcgat
aattacttggatatgattgacacatatcaagcaatcatcttgtcttatttagcataa

DBGET integrated database retrieval system