KEGG   Enterococcus hirae: EHR_08455Help
Entry
EHR_08455         CDS       T02160                                 

Definition
(GenBank) carboxylesterase precursor
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
ehr  Enterococcus hirae
Brite
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EHR_08455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 DLH Peptidase_S9 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 BAAT_C DUF2048 DUF3828
Motif
Other DBs
NCBI-ProteinID: AFM70616
UniProt: I6T790
Position
1672635..1673384
Genome map
AA seq 249 aa AA seqDB search
MKSLPKPLYAKHSKRAVLLLHAYSGSPNDVRMLARYLEKSEYTVYAPLFTGHGTLAPQDI
LAQKTETWWEDTKQAIHFLKAEGFSQVAVFGLSMGGIFAVRALAEQSEIIGGGCFCSPIS
PVENHVPENFERYERYVLKLAGESEQEIEETVAALRPNVYQQLAEIQNQAAITEGKLSDI
QAPVFLAQAGQDEMIDPAGVYEIAKKLADKRVTLQWYPNSKHVITVGESRKLLEKDVLEF
LENLPWNEE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtctaccaaaacccctttatgcaaaacatagtaagagagctgtgctactctta
catgcctattctggaagtccgaatgatgtgcgcatgctggctcgatatttggaaaagtca
gaatatactgtctatgctccattatttactggacatggaacgctagctccacaagacatt
ttagcgcaaaaaacggaaacatggtgggaagatacgaaacaagccatccactttttaaaa
gcagaaggtttttcccaagttgccgtttttggattatcaatgggaggaatcttcgctgtt
cgagcattagcagaacagtcagagatcattggtggcggatgtttctgctcaccgatttca
ccagttgaaaatcatgtaccagaaaattttgagcgatatgaacgttatgtgctaaaactt
gcaggggaatctgaacaggaaatcgaagaaactgtcgctgcgcttcgaccaaatgtttat
cagcaattagcagagatacaaaaccaagcagcaattacagaaggaaaacttagtgacatc
caagcacctgtttttttagcccaagccggtcaagatgaaatgattgatccagctggagtc
tacgaaatagcaaaaaaattagccgataaaagagtgacccttcaatggtatcccaacagc
aaacatgtgatcaccgttggagagtctagaaaattactggaaaaagatgtgttggagttt
ctagagaatttaccttggaatgaggaatga

DBGET integrated database retrieval system