KEGG   Enterococcus hirae: EHR_08705Help
Entry
EHR_08705         CDS       T02160                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ehr  Enterococcus hirae
Pathway
ehr00040  Pentose and glucuronate interconversions
ehr00052  Galactose metabolism
ehr00500  Starch and sucrose metabolism
ehr00520  Amino sugar and nucleotide sugar metabolism
ehr01100  Metabolic pathways
ehr01130  Biosynthesis of antibiotics
Module
ehr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHR_08705
   00052 Galactose metabolism
    EHR_08705
   00500 Starch and sucrose metabolism
    EHR_08705
   00520 Amino sugar and nucleotide sugar metabolism
    EHR_08705
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EHR_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFM70662
UniProt: I6SYX5
Position
1716220..1717158
Genome map
AA seq 312 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAK
RPIEDHFDSNIELETNLSEKGKTELLKLVEETTDVNLHFIRQSHPKGLGHAVLQARAFIG
NEPFVVMLGDDIMEDEVPLTQQLIDDYERTHASTIAVMEVPQKDTSKYGIINPGEELEEG
LFNVKNFVEKPDPSKAPSNLAIIGRYLLTPEIFDVLAEQQPGAGNEIQLTDAIDTLNKTQ
RVFARNFTGKRYDVGDKFGFMKTSIEYGLTHPEVGEPLKEYIKELGKQLEADQTMVPKKD
NKKIESKDELKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaggcagttattccagcagcaggtttaggaacaagatttttacctgca
acaaaagcgatggcaaaagaaatgcttccaatcgttgacaaaccaacgattcaatttatc
gtagaagaagcacttaaatcagggatcgaagacattttgatcgtcactgggaaagcaaaa
cgaccaatcgaagaccattttgattcaaatatcgagttagaaacgaatttgagtgaaaaa
gggaaaacagaattattgaagttggttgaagaaacaactgatgtaaatctacacttcatt
cgtcaatctcatccaaaagggttaggacatgctgtattacaagcccgtgcttttatcggt
aatgaaccttttgttgtgatgttaggtgatgatatcatggaagatgaagtacctttgaca
caacaattgattgatgactatgagcggacacatgcatcaacaatcgcagtgatggaagtg
ccacaaaaagatacgtctaaatacggaattattaatcctggtgaagaattagaagaagga
ttgttcaatgttaaaaacttcgttgaaaaaccagacccaagtaaagcaccaagtaattta
gctattattggacgctatttattaactcctgaaatctttgatgttttggcagaacaacaa
ccaggtgctgggaatgaaatccaactgacagatgcgattgatacattgaataaaacacaa
cgagtatttgctcgtaactttacaggcaaacgctatgatgttggtgacaagtttggtttc
atgaaaaccagtatcgaatacggcttgactcatccagaagtcggcgaaccattaaaagaa
tatatcaaagagctagggaaacaattagaagctgatcaaacgatggtaccaaaaaaagac
aacaaaaaaattgaatcaaaagatgagctgaaaaaataa

DBGET integrated database retrieval system