KEGG   Enterococcus hirae: EHR_08795Help
Entry
EHR_08795         CDS       T02160                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ehr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735491..1736924
Genome map
AA seq 477 aa AA seqDB search
MAFRKDFLWGGATAANQCEGGYAEGGRGLANVDVVPIGKDRFSVITGKQKMFDFDEEHFY
PAKTAIDMYHRYKEDIALFAEMGFKTYRLSIGWSRIFPKGDEKEPNEEGLKFYEDVFKEC
QKYGIEPLVTITHFDCPMHLVKEYGAWRSRKLIEFYERLCHVIFNRYKGLVKYWLTFNEI
NMILHAPFMGAGLYFEEGDDVEQIKYQAAHHELVASAIATKIAHEVDPENKVGCMLAAGA
IYPYTCKPEDVWASRKADRENYFFIDVQSRGSYPAYALKEMARNGIKIEMEPTDLEILKE
HTVDFISFSYYSSRVATTDSKVLEQTAGNIFESAKNPYLSASEWGWQIDPLGLRITMNDL
YDRYQKPLFIVENGLGAIDTPDENGYVEDDYRIDYLAQHIQAMKDAVELDGVDLLGYTTW
GCIDLVSAGTGEMKKRYGFIYVDRDNEGNGTLERSKKKSFNWYKKVIATNGEDLSNE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaggaaagactttttatggggtggcgcaacggctgccaatcaatgtgaagga
ggctacgctgaaggtggacgtggtttagctaatgttgatgttgttccgattggtaaagat
cgtttttcagtgatcactggtaaacaaaaaatgtttgactttgatgaggaacatttttat
ccagcaaaaacagccattgatatgtaccatcgttacaaagaggatattgcactttttgcg
gaaatgggatttaaaacctatcgcttatccattgggtggagtcgtatttttccaaaaggt
gatgaaaaggaaccaaatgaagaagggttgaagttctatgaagatgtctttaaagaatgt
caaaaatatggaatcgaaccgttagtgacaatcactcattttgattgtccgatgcattta
gtcaaagaatatggtgcttggcgttctcgaaagttgatagagttttatgaaagactttgc
catgtcatttttaatcgttacaaaggattagtgaaatactggttgaccttcaacgaaatc
aatatgattttacatgctccatttatgggcgctggattgtattttgaagaaggggacgat
gtggaacaaatcaaataccaggcagcccatcatgaattagttgctagtgcaatcgctaca
aagatcgctcatgaagtggatccagaaaataaagttggctgtatgttagcagccggcgca
atttatccttacacttgtaaacctgaagatgtctgggcttcaagaaaggcggaccgggaa
aactatttctttattgatgtccagtcaaggggaagttatccagcctatgccttaaaagaa
atggcacgtaatggaatcaaaatcgagatggaaccaactgacttagaaatattaaaagaa
cataccgttgattttatttcattctcctattactcttcccgggtagctactactgattca
aaagtattagagcaaacggccggtaatatttttgaatcggctaaaaatccttatctttca
gccagtgaatggggctggcaaattgatccattggggttacgtatcacgatgaatgatctt
tatgatcgttaccaaaaaccattgttcatcgtcgaaaatgggttaggtgccattgataca
ccagatgaaaatggctatgtagaagacgactatcggatcgattatttagcacaacatatc
caagcaatgaaagatgcggttgagctcgatggtgtggatctcctaggctacacgacttgg
ggctgtatcgatcttgtctctgctgggactggcgaaatgaagaaacgctatgggttcatc
tacgttgaccgtgacaacgaaggaaatgggacattggaacgctcgaagaaaaaatcgttc
aactggtataaaaaagtcattgcaacaaatggagaagatttaagtaacgaatag

DBGET integrated database retrieval system