KEGG   Enterococcus hirae: EHR_10100Help
Entry
EHR_10100         CDS       T02160                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_10100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_10100
   00052 Galactose metabolism
    EHR_10100
   00500 Starch and sucrose metabolism
    EHR_10100
   00520 Amino sugar and nucleotide sugar metabolism
    EHR_10100
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EHR_10100
   00524 Butirosin and neomycin biosynthesis
    EHR_10100
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EHR_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1953017..1953982
Genome map
AA seq 321 aa AA seqDB search
MDKKIIGIDLGGTTAKFAILTPEGEIQQKWSIDTNILDDGKHIIPEIIESVNHRIKLYNM
NAENFIGIGMGTPGSVDSEAGTVIGAYNLNWTELQYVKKQIEEGTGIKFAIDNDANVAAL
GERWKGAGENDPDVIFVTLGTGVGGGIVAAGNLIHGVAGAGGEIGHITVDPEGFECTCGK
RGCLETVSSATGVVRLARFLAEEYAGDSKLKAMLDNGEEVTSKDIFEMAQADDPFGLMVV
DRVCFYLGLACGNLGNTMNPSSIVLGGGVSAAGEFLRSRVEKYFNQFTFPQVQQSTKIKL
AELGNEAGVIGAASLALKFAE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaattattgggattgatttaggtggaacaacagcaaaatttgcaattcta
acaccagaaggagagattcaacaaaaatggagcatcgataccaatatattggatgacggt
aaacatattattccggaaattatcgagtcagtaaatcatcgtatcaaattatataacatg
aatgctgaaaatttcatcggaatcggtatgggaacaccaggaagtgtcgatagtgaagca
ggtacagtgatcggagcctacaatttaaattggactgaacttcaatacgtaaaaaaacaa
attgaagaaggaactggaatcaaatttgctattgataacgatgcgaacgttgctgcttta
ggtgagcgctggaaaggtgcaggggaaaatgatcctgacgttatttttgttaccttagga
acgggtgtcggtggcggaatcgttgctgctgggaacttgatccacggcgttgctggtgca
ggtggcgagattggacacattacagtggacccagaaggttttgaatgtacatgcggtaaa
agagggtgcttagaaacagtttcaagtgcaacaggtgtagttcgcttagcacgtttctta
gcagaagagtatgccggagattcaaaattaaaagcaatgcttgacaatggagaagaagta
acaagtaaagatatttttgaaatggcacaagcagacgatccatttggtctgatggtcgtt
gatcgtgtttgtttctacttaggattagcttgcggtaatctagggaacactatgaaccca
tcaagtattgttttaggcggcggagtatctgctgccggggaatttttacgtagtcgtgtt
gaaaaatatttcaaccaatttacgttccctcaagtacaacaatcaacaaaaatcaaatta
gcagaattaggaaatgaagctggcgtgatcggtgctgcttcattagccttgaaatttgcg
gaataa

DBGET integrated database retrieval system