KEGG   Enterococcus hirae: EHR_10495Help
Entry
EHR_10495         CDS       T02160                                 

Definition
lacto-N-biosidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ehr  Enterococcus hirae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EHR_10495
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EHR_10495
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EHR_10495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032223..2033284
Genome map
AA seq 353 aa AA seqDB search
MMNESNKPISVTKAPSLKERGVILDIGRKFYSIDFLKELVDYMASLKMNALQLHFSDNEG
FRLECETIPEITSEKFLTKQEMTDLIDYAEQKGISVIPEFDSPGHLQRLLAIYPQWQMER
KGEDSLIFPTNRALDITKKDAVAMIKKMIKEYAELFHRSDYFHLGADEYIEFSELDKYPA
LKAQAIAEYHDPTRQYDVFIDYINELADYVETLGKKARIWNDGVYKKGLLMKSKLKPSIQ
ITYWTKHQATMATAGEFLTRDHQLINVNDQFFYFVLGEGASYKYPTAQKIQDNWTIDQFP
ENQRLTNEQMKKVQGAYFAIWSDYPDALTEEEVLTMIKEPLAAQQQIIWHETI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaatgaatcaaacaagccaatatctgttacaaaagcaccttctttaaaagagcgt
ggcgtgattttagatattggacgtaaattttattcaatagattttctaaaagaacttgta
gactacatggcttcattgaaaatgaatgctttgcaacttcacttttctgataatgaagga
tttcggttggaatgcgaaacaattccagaaatcacatcagagaaatttttgacgaaacag
gaaatgacggatttgattgattatgcggagcaaaaggggatttctgtgattccagagttt
gatagtcctggtcatttgcaacggttgttggcaatctatccacaatggcaaatggagcga
aaaggcgaggattctttgatttttcccactaatcgagcccttgatatcaccaaaaaagat
gcggtcgccatgatcaaaaagatgataaaagaatatgcagagttatttcatcgttccgat
tatttccatttaggggcagatgaatacattgaattttcagagttggataaatatcctgca
ttaaaagcacaagcaatcgctgaataccacgacccaactcgtcagtatgatgttttcatc
gactacatcaatgagttagcagactatgtcgaaacattaggtaaaaaagctagaatttgg
aatgatggtgtctataaaaaaggactgctcatgaaaagtaaattaaaaccttctattcaa
attacgtattggacaaaacatcaagcaacaatggcgactgcgggggaatttctcactcgt
gaccatcaattgatcaatgtcaacgatcaatttttctattttgttttaggagaaggtgcc
agttataaatatcctacagctcaaaagattcaagacaactggacgattgatcaatttcct
gaaaatcaacgattaacaaacgaacaaatgaaaaaagtacaaggtgcctattttgctatc
tggagtgactaccctgatgctttgactgaagaggaagtcttaacgatgattaaagaacca
ttagctgcacaacagcaaatcatctggcacgaaacaatatga

DBGET integrated database retrieval system