KEGG   Enterococcus hirae: EHR_10870Help
Entry
EHR_10870         CDS       T02160                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ehr  Enterococcus hirae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EHR_10870
  Lipid metabolism
   00561 Glycerolipid metabolism
    EHR_10870
   00600 Sphingolipid metabolism
    EHR_10870
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EHR_10870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2120768..2123005
Genome map
AA seq 745 aa AA seqDB search
MEQVMKNQRVALITFDEQEKVFHLSNSEISYILQIEESEVLAHVYFGKRTTHYHNHKKYP
RRDRGFSGNVPLNEDRTYSKDTLPQEYSGHGGMDYRLPALMIRRENGSNLLDLRYESFQI
QEGKPNLSGLPQAYIKNDTEAETLIVTLKDREEKIYVDLSYTIYRERAVITRSLKVRNET
NDPVMIEKAASFQLDFTNSGRFDEVIALPGAHVKERQMSRQSITDGIKSFESRRGSSSHQ
MNSFIALTNHATTEFTGEAIGIHLVYSGNHSFEIEKDAIQQFRVIGGINPYNFSWELQPY
ESFQTPEILLTYSDQGLNGMSQVTHHLLRERVARGRFQYQERPILVNNWEATYFDFTSKK
IEAIVDEANELAIEMFVLDDGWFGKRDSDQSSLGDWFEYQGKLKNGLKGIADYVHQKGLK
FGLWVEPEMVSSDSQLNRNHPEFMMKEPGRQPSASRSQHVLDFTRKEVRQTIETQLRHLL
DSVEIDYIKWDMNRSLSDVYSVSLGKQNQGEVLHRYLLGLYEMMENLTNDYPHILWEGCS
GGGGRFDAGLLYYMPQSWTSDNTDAVERINIQYGTSLAYPISAMTAHVSAVPNHQTGRVT
SLKTRGDVAMGGVFGYELDLTKLSSEEKQEVAAQVEFYKKIRQTVQYGDFYRLQNPFEQN
IASWEFVSKNQQEVLLFINRRLANAQPEFHEVRLVGLSEEKLYQNQIDGKVYSGSELMTI
GLYFPDFYGDFQTELIHFMSIDEGE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagtgatgaagaatcaaagagtagctttaatcacatttgacgaacaggaaaaa
gtatttcatctatccaattcagaaatttcctatattcttcaaattgaagaaagtgaagtt
ctggctcatgtttattttggtaaaagaacgacccattatcataatcataaaaaatatcct
cgcagagatcgtggcttttctgggaacgtccccttaaatgaagatcgaacgtattcaaaa
gatacattaccacaagagtattcagggcacggagggatggattatcgattacctgccttg
atgattcgtcgagaaaatggatcaaatctgcttgatctacgttatgaaagttttcagatc
caagaaggaaagccaaatttatctggattaccgcaagcgtatatcaagaatgatacagag
gcagaaacattgatcgtgacgttgaaagatcgtgaagaaaagatttacgtggatctttcc
tatacgatttatcgagaaagagcagtgattacacgttcgctgaaggtaagaaatgaaacc
aatgatccagtgatgattgaaaaagcagcctcttttcaacttgattttacgaattcaggc
cggtttgatgaagtgattgccttaccaggagcgcatgtcaaagaacggcagatgtctaga
caaagcataacagatggcatcaaatcatttgaaagccgtcgtggttcaagcagtcatcag
atgaattcattcatcgccttgacaaatcatgcaacaactgaattcacaggggaagcgatt
gggatccatcttgtttattcaggaaatcattcctttgagattgaaaaagatgccattcaa
caatttagagtgatcggtggaatcaatccctataatttttcttgggagttacaaccatat
gaaagcttccaaacaccggaaatactcttaacttattctgatcaagggttgaatgggatg
agtcaagtgacccatcatttattacgggaacgagtagcaagagggcgattccaataccaa
gaacgtccgatcctagtcaacaattgggaagcgacttattttgactttacgagcaaaaag
atcgaagcgatcgttgatgaagcaaacgaattagcgatagagatgtttgttttagatgat
ggctggtttgggaaaagagattcggaccaatcttctctaggagactggtttgaatatcaa
gggaaattgaaaaatggcttaaaagggatcgctgactatgttcaccaaaaaggactaaag
tttggcttgtgggttgagcctgaaatggtttccagcgactctcaattaaatcggaatcat
cccgaatttatgatgaaagaaccaggtcgtcaaccatcagcttctagatctcaacacgtc
cttgattttacccgaaaagaagtccggcagacgattgaaacacagttacggcatttgtta
gacagtgtggagatcgactatatcaaatgggatatgaatcgatcgctatctgatgtctat
tcggtgtcattgggcaaacaaaaccaaggggaagttttgcatcgttatctattaggatta
tatgagatgatggaaaacttaacaaacgactatcctcatatcctttgggaaggatgttct
ggtggtggtggacggttcgatgcagggctgctttattatatgccacagtcttggactagt
gacaatacagatgcggttgaacgcatcaatatccaatatgggacgagcttagcttatcct
atttcagctatgactgcccatgtatcagctgttcctaatcatcaaacgggtcgagtcacc
agtttaaaaacacgtggagatgtggccatgggcggggtgtttggatatgaactcgatcta
acaaaattatctagtgaggaaaagcaggaagtagccgcacaggtagaattttataaaaaa
atcagacagacagtccaatatggtgatttctatcgtttacaaaatccctttgagcaaaat
attgcttcctgggaatttgtttcaaaaaaccaacaggaagtcctcttatttataaatcgt
cggttagcaaatgcacagcccgaatttcatgaggtacgccttgttggactaagcgaagaa
aaactataccagaaccagatagatggcaaagtatattcaggatcggaattaatgacaata
ggtctttatttcccagatttttatggcgattttcaaacagaattgattcattttatgagt
atagacgaaggagaatag

DBGET integrated database retrieval system