KEGG   Enterococcus hirae: EHR_10995Help
Entry
EHR_10995         CDS       T02160                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_10995 (gpmA)
   01230 Biosynthesis of amino acids
    EHR_10995 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_10995 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EHR_10995 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EHR_10995 (gpmA)
Enzymes [BR:ehr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EHR_10995 (gpmA)
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EHR_10995 (gpmA)
  Exosomal proteins of melanoma cells
   EHR_10995 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2150741..2151409
Genome map
AA seq 222 aa AA seqDB search
MKLVLLRHGESEANFQNYWTGWLDVALTEKGMQQATEAGRKMNEQGLVFDIVYTSVLKRA
IKTSQLALEEMNQLYLPVQKTWRLNERHYGALVGKNKTEMKKEYGEEQVKKWRRGYREVP
PLVSENHFDRRYDSLDPRLLSHGESLEMTVERVVPLWQDELAPHLLGGKNVLVVGHGNSL
RALTKYLEDVPENQLDTIDIPNAQPIQYTLNKELEILGKELL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtcttattacgacatggtgaaagtgaagccaattttcaaaattattggact
ggctggttagatgttgcgctaactgaaaaggggatgcaacaagcaacggaagctggacga
aaaatgaatgagcaaggattggtttttgatatcgtttatacatctgtactaaaaagagca
atcaaaacgtcacagttagctttagaagaaatgaatcaattgtatcttcccgtccaaaaa
acttggcggttaaatgaacgacattatggggcattagttggtaaaaataaaacggagatg
aaaaaagaatatggcgaagaacaagtcaaaaaatggcgtcgtggctatcgagaagttccg
ccactcgtatcagaaaaccattttgatcgacgctatgattctttagatccacgtttgctc
tcccatggtgaaagcttagagatgacagttgagcgcgtggttcctttatggcaagatgaa
cttgcaccacacttattaggtggtaaaaatgtcttagtggttggacatgggaatagctta
cgtgcgttaacgaaatacttagaagatgtaccagaaaatcagttggatacgattgatatc
ccgaatgcgcaaccgattcaatacactttaaataaagagttagaaatcctcggaaaagaa
ttgttataa

DBGET integrated database retrieval system