KEGG   Enterococcus hirae: EHR_11785Help
Entry
EHR_11785         CDS       T02160                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ehr  Enterococcus hirae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EHR_11785
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EHR_11785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2292192..2292749)
Genome map
AA seq 185 aa AA seqDB search
MNKCYVFIGPSGSGKTSIANALFEPKEKIVTSTTRPPRKGETDQKDYYFLSEDKFEQLIT
EQAFVEWDEYAGHKYGSTKREIAQKLKNGDCYTILTAAGFWALFHAFGEQIQPVFVTIAK
NKLKQRLEQRGDAPDQIKKRLALFEQDTKKLDELKKRPNLIVLANNEGLEATKNQFKRQI
KMLKE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatgttatgtatttattggtccttctggttcaggaaaaacctccattgctaat
gctctttttgaaccaaaagaaaaaattgtcacttcgacgactcgtcctcctcgaaaaggt
gaaaccgatcaaaaagattactattttctctctgaagacaaatttgagcagttgatcact
gaacaggcatttgtggaatgggatgaatatgcgggacataaatatggttcaactaagagg
gagattgctcaaaagttgaaaaatggtgattgttatacaattttaacagctgctggtttt
tgggcactcttccatgcatttggggaacagatccaaccagtatttgtgactatcgctaaa
aacaaattgaagcagcgtttagaacaacgtggagatgctccggatcaaatcaaaaaaagg
ctcgctctttttgagcaagacacgaagaaattagatgagttaaaaaaacgaccaaacctc
attgttttagcaaataatgaagggttagaagccaccaaaaaccaatttaagcgacaaata
aaaatgctcaaagaatga

DBGET integrated database retrieval system