KEGG   Enterococcus hirae: EHR_12130Help
Entry
EHR_12130         CDS       T02160                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ehr  Enterococcus hirae
Pathway
ehr00240  Pyrimidine metabolism
ehr00250  Alanine, aspartate and glutamate metabolism
ehr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EHR_12130 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EHR_12130 (pyrB)
Enzymes [BR:ehr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EHR_12130 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace TACI-CRD2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFM71293
UniProt: I6SF80
Position
complement(2357349..2358275)
Genome map
AA seq 308 aa AA seqDB search
MIIKSERISLKHLLTVEALTDQEVMGLIRRGQEFKQGANWTPQKPQYFATNLFFENSTRT
HKSFDVAEKKLGLEVIEFEASTSSVQKGETLYDTVLTMSALGVDVAVIRHGDENYYDELI
QSKTIQCSIINGGDGSGQHPTQCLLDLMTIYEEFGYFEGLKVAIVGDITHSRVAKSNMQM
LKRLGAQVFFSGPREWYDEEFEVYGHYLPLDELLEQVDVMMMLRVQHERHDGKESFSKEA
YHQEYGLTVERAKKLQKHAIIMHPAPVNRDVELADSLVEGLQSRIVQQMSNGVFVRMAIL
EAVLNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaatcagaacgcattagtttaaaacatttattgacagtggaagctttaacg
gatcaagaagtcatgggcttgatccgacgaggtcaagagtttaaacaaggagcaaactgg
acaccacaaaaaccgcaatactttgcgacgaatctgttttttgaaaatagtactcgtacg
cataagagcttcgatgtagccgaaaagaaactaggcttagaagtgattgaatttgaagcg
agtacgagttctgtacaaaaaggggaaaccctttatgatacggtcttgacgatgtctgcg
ctcggtgtggatgttgcagtaatccgccatggagatgaaaattactatgatgaattgatc
caaagtaaaacgatccaatgctcgattatcaatggtggtgacggaagtggccaacatcca
acacaatgcttacttgatttgatgacgatctacgaagaatttggttactttgagggattg
aaagtagcgatcgtcggggatatcacacactcacgagtagcaaaatcaaacatgcaaatg
ctgaaacgattaggagcacaagttttcttttcaggtccacgtgaatggtacgatgaagaa
tttgaagtctatgggcactacctgccattagatgaattattagaacaagtggatgtcatg
atgatgcttcgagtacaacatgaacggcatgatgggaaagaaagtttttcgaaagaagcc
tatcaccaagagtatggattaacagtcgaacgtgcgaagaaattacaaaagcatgcgatc
atcatgcacccagcgccagtcaatcgtgatgtcgaattagctgattcccttgtggaagga
ctacaatcacgaatcgtacagcaaatgagcaatggcgtctttgttagaatggcgatctta
gaagcagtactaaacggaaaagcgtaa

DBGET integrated database retrieval system