KEGG   Enterococcus hirae: EHR_12855Help
Entry
EHR_12855         CDS       T02160                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ehr  Enterococcus hirae
Pathway
ehr00010  Glycolysis / Gluconeogenesis
ehr00020  Citrate cycle (TCA cycle)
ehr00620  Pyruvate metabolism
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01120  Microbial metabolism in diverse environments
ehr01130  Biosynthesis of antibiotics
ehr01200  Carbon metabolism
Module
ehr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_12855
   00020 Citrate cycle (TCA cycle)
    EHR_12855
   00620 Pyruvate metabolism
    EHR_12855
Enzymes [BR:ehr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EHR_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFM71436
UniProt: I6T9A8
Position
complement(2501058..2502695)
Genome map
AA seq 545 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVI
VPEGTVANVGDVLVEIDAPGHEDNETSGDAGVAAKEQTPEHPAAEPTEASADGGVFEFKL
PDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNILVSEGTVA
TVGDVLVEIDAPGHNSAPSTTSEKTAESTDAKVETSGSASVAEAADPNKRVLAMPSVRQF
AREKDVDITQVTATGKGGRVTKEDIESYLSGGHASQTASAEPAAPASEKAVEAKAESKPA
APAKAFKSNLGELEERVAMTPTRKAIAKAMVNSKQTAPHVTLHDEVEVSKLWDNRKRFKE
VAAANGTKLTFLPYVVKALTATVKKFPILNASIDDANQEIVYKNYYNIGIATDTDHGLYV
PNVKDADRKGMFAIADEINEKAKLAHEGKLAAEDMRNGTITISNIGSVGGGWFTPVINYP
EVAILGVGTIAQQPIVNGEGEIVVGRVMKLSLSFDHRIVDGATAQQAMNNIKRLLADPEL
LMMEG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcataccaatttaaattacctgacattggtgaaggaatcgcagaaggcgaaatcgtc
aaatggtttgtcaagccaggcgataccatcaatgaggatgatacgttattagaagttcaa
aatgataaatcagtagaagaaattccatccccagttactgggacagtgaaaaacgtcatc
gtacctgaaggaacagtcgcgaatgttggcgatgtactggtagaaatcgatgcaccagga
catgaagacaatgaaacaagtggcgatgctggagtagcagcgaaagagcaaacacctgaa
catccagctgctgaaccaactgaagctagtgccgatggtggggtctttgaatttaaatta
cccgatattggtgaaggaatcgcagaaggtgaaatcgttaaatggtttgtgaaaccaggc
gataccatcaatgaagatgacacattgttagaagtacaaaacgataaatcggtagaagaa
atcccgtcaccagtgactggaacggttaaaaacatcttggtatcagaaggaacagttgca
actgttggtgatgtattagtagaaatcgatgcaccaggacataatagtgcgccttctact
acatcagaaaaaacagctgaatcaactgatgctaaagtagaaacttctggttcagcatca
gtagctgaggcagctgatcctaacaaacgtgttttggctatgccatcagttcgacaattt
gctcgtgaaaaagatgtggatatcacacaagtcactgcaactggtaaaggcggacgtgtg
acaaaagaagatattgaaagttatctatcaggtgggcatgcgagtcaaacagcatcagct
gaaccagctgcacctgcgtcagaaaaagcggttgaagcgaaagctgaaagcaagccagca
gcaccagcaaaagcgttcaaatctaatttaggtgaattggaagaacgtgtagcgatgaca
ccgacacgtaaagcgattgctaaagcaatggtcaatagcaagcaaacagcgccacatgtt
actttacatgatgaagtagaggtttctaaactttgggataatcgtaagagatttaaagaa
gtggcagctgcgaatgggacaaaattgactttcttgccatacgtggtaaaagcattaact
gctactgtgaagaaattccctattttgaatgcgtcaattgatgatgcgaaccaagaaatc
gtttataaaaattactataacatcggaattgcaactgatacagatcatggcttgtatgta
ccaaatgtaaaagatgcagaccgtaaaggcatgtttgcgattgcggatgaaatcaatgaa
aaagcaaaactagctcatgaaggtaaattagcagctgaagatatgcgaaatggcactatt
acgatcagtaacattggttctgtaggtggcggttggtttacaccagtaatcaactaccct
gaagtagcaattttaggtgtgggaacaattgcacaacaaccgatcgttaatggtgaaggt
gaaatcgttgttggacgagtgatgaaactttccttaagctttgatcaccgtatcgtagac
ggagcaacagctcaacaagcaatgaacaatatcaaacgacttttagctgatcctgagtta
ttgatgatggaaggatga

DBGET integrated database retrieval system