KEGG   Emiliania huxleyi: EMIHUDRAFT_101090Help
Entry
EMIHUDRAFT_101090 CDS       T02915                                 

Definition
(RefSeq) NADH-cytochrome B5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EMIHUDRAFT_101090
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     EMIHUDRAFT_101090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 Phage_TAC_6
Motif
Other DBs
NCBI-GeneID: 17270247
NCBI-ProteinID: XP_005777129
JGI: Emihu1_101090
UniProt: R1EDB4
Position
Unknown
AA seq 295 aa AA seqDB search
MLAASLTTASVPPADTCSAAGSLPYTLTNKTRLSPDSWLLRFALPRRYLGDDPSLPTCLK
VLHPEGTDEAGRPKRLEKSYSPVSHPATEGSVDLVVKAYEPRPGGGVGTWLCGLEEGAVM
HAVLKAKRVMHGDAAVVGRWQHVGLVGGGTGIAPLLQIARILLEDTGSAPAASVRLLSVN
RREEDILARQELEALAAAHPDRFRVSYSLTAPPAGWEGLTGRGSAELITAALPPPRGDGS
TMVLVCGTDGFVELWGGPVARAPKQPGEKKGAKVQGPLLGLLAEAGFDASEVFKY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgccagcctcaccacagcctcggtgccgccggccgacacctgcagcgccgcg
gggtcactgccttatacgctgacaaacaagactcgcttgagccccgactcgtggctgctg
cgttttgccttgccgcgccggtacctgggcgacgacccctcgctgccgacgtgcctcaag
gtcttacatcccgagggcacggacgaggccggccggcccaagcgcctcgagaagagctac
tctccggtctcgcatccagccaccgagggctctgtcgacttggttgtcaaggcatatgag
ccgcggccgggcggcggcgtcggcacatggctgtgcggcctcgaggagggtgccgtgatg
catgcggttctcaaggccaagcgggtcatgcacggcgacgcggcggtcgttggccgctgg
cagcacgtcggcctcgtcggcggtggcaccggcatcgcgccgctgctgcagattgcgcgc
atcctgctcgaggacaccggcagcgctccggcggcgagcgtgcggctgcttagcgtgaac
cggcgcgaggaggacatacttgcgaggcaggagctcgaagcactggccgccgcgcacccg
gaccgcttccgagtgagctactcgctgactgcgccgccggcgggatgggagggcctcacg
gggagggggtcggcggagctcatcacggcggcgctgccgcctccgcgcggcgacggcagc
acgatggtgctggtctgcggcacggacggcttcgtcgagctgtgggggggtccggtggcg
cgcgcgcccaagcagccgggcgagaagaagggcgcgaaggtgcagggcccgctcctcggg
ctcctcgccgaggccggcttcgacgcgtccgaggtgttcaagtactga

DBGET integrated database retrieval system