KEGG   Emiliania huxleyi: EMIHUDRAFT_104256Help
Entry
EMIHUDRAFT_104256 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ehx  Emiliania huxleyi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EMIHUDRAFT_104256
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     EMIHUDRAFT_104256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 500 aa AA seqDB search
MSASATTRFGMLHGTALGEGSVSVHQYLGVPFAEPPRRFADPIDWSAPFEGGVRLAMRPG
SVCVQPTVTAGDGFQGSEDCLFLNVWAPAPSTVPLPVLFFVHGGDFLSGSGGEYNSSRLA
ARHRVVVVTTNYRLGALGWARLSEGRANWGLKDQRSALRWVRSNIAAFGGDPRRLCIFGE
SAGASSVALHLLSPASRGLFGAALMESGSPIATPAGAAEELAADFFRHSGCGEAQRRGGQ
AVLSCLRAAPIARLWRAASAATAPPPGGGFLDQRTFASVVDGVEVPARPFELVASGALAR
VALLGGTNTDEGSGFVLPAVKRPLSAAAYTDYISKLTLRLEVPRANLSDVLAVYPPRPAA
DNANSRGNRAYLYRFDQRARDDTSEPVDWGVTHGSEVPFVFERGSWIDSGNTSFTPAERL
LSVAIGGMWAAFASRAQPLPPAAWPAYRNGSEAQLVLSIREDATAPPPFRVEVPPRAREC
DFWERLQALVRDKEQRVAAS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctcggcgacgactcgattcggcatgctccacggcactgccctcggcgagggc
agtgttagcgttcaccagtacctcggtgtcccatttgcggagcctccgcgccgctttgcg
gatcccatcgactggtcggcgccattcgagggcggcgtgcgcctggcgatgcggcccggc
agcgtctgcgtgcagcctaccgtcacagccggcgacggctttcaaggctcggaggactgc
ctctttctcaacgtctgggctccggcgccgtcgaccgttcccctcccggtcctcttcttt
gtgcacggcggcgactttctcagcgggagcggcggcgagtacaactcgagccggctggcc
gcgaggcacagagtggtggtggtgaccacaaactaccggctcggcgcgctgggctgggcg
cggctctccgagggccgcgccaactggggcctgaaggaccagcggagcgcgctgcgctgg
gtccggagcaacatcgccgcgtttggcggcgacccgcgccggctctgcatctttggggag
agcgccggcgccagctcggtcgcgctccacctcctctcgcccgcctcccgcggcctgttt
ggcgcagcgctcatggagagcggatcgcccatcgccactccggccggcgccgccgaggag
ctcgccgcggacttctttcgccacagcggctgcggtgaggcccagcggaggggcggccag
gccgtgctctcctgcctgcgcgcagcgccgatcgcacgcctctggcgcgccgcctccgcc
gccactgctcctccgccgggcggcggcttcctcgaccagcgcaccttcgcctcggtcgtc
gacggcgtcgaggtgcccgcgaggccctttgagcttgtcgcgagcggcgcgctggctcgc
gtcgctctcctcggagggacaaacaccgacgagggctccggctttgtgctgccggccgtg
aagcggccgctctccgcggctgcctacaccgactacatctccaagcttactctgcgcctc
gaggtgccgcgtgcgaacctctcggacgtgctggcggtgtaccctcctcggcctgccgcc
gacaacgcaaactctcggggcaaccgcgcctacctctaccgcttcgaccagcgggcgagg
gacgacacctccgagccggtggattggggcgtcacgcacggcagcgaggttccattcgtc
ttcgagcggggcagctggatcgacagcggaaacacgagcttcacgcccgccgagcgcttg
ctctccgtcgcgatcggcggcatgtgggccgcgtttgcctcgcgcgcacagccgctgccg
ccagcagcgtggcccgcctaccgaaacgggtctgaggcgcagctggtgctctcgatccga
gaggatgccacggcgccacccccctttcgggtggaggtgccgcctcgggcgcgagagtgc
gacttctgggagcggctgcaggcgctagtgcgagacaaggagcagagggtcgcggcgtcg
tga

DBGET integrated database retrieval system