KEGG   Emiliania huxleyi: EMIHUDRAFT_124204Help
Entry
EMIHUDRAFT_124204 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
Organism
ehx  Emiliania huxleyi
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 156 aa AA seqDB search
MHGAGTAVLSCLTLASAISPTLLLHVGAPLRVAFGSCRKQLKPQPVWDAVAAQSPALWLW
LGDAMYPKGSVTSAAQLREAYAQAGEPALRGVPVDGVYDDHDYGLNDGGVGWELKEDARQ
LFLDEVVGAPADSARRTQRGGLYGSRTLGEPPRQLK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcgccggcacggccgtactctcctgcctcacccttgcctccgccatcagcccg
acccttctactgcacgtcggcgcaccactgcgcgtggcgttcggctcttgccggaagcag
ctcaagcctcagcctgtgtgggacgccgtcgccgcgcagtcgccggcgctgtggctgtgg
ctgggcgatgccatgtacccgaaagggtcggtgacatctgccgcgcagctgcgtgaggcg
tacgcgcaggcgggcgagccggcgctgcgcggcgtgccggtcgacggcgtatacgacgat
cacgactacgggctgaacgacggcggcgttggctgggagctgaaggaggacgcgcggcag
ctcttcctcgacgaggttgtcggcgcgcccgccgactcggcgcggcgcacccagagagga
ggcctctacggcagccgcacgctcggcgagccgccccggcagctcaag

DBGET integrated database retrieval system