KEGG   Emiliania huxleyi: EMIHUDRAFT_194638Help
Entry
EMIHUDRAFT_194638 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ehx  Emiliania huxleyi
Pathway
ehx01040  Biosynthesis of unsaturated fatty acids
ehx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EMIHUDRAFT_194638
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     EMIHUDRAFT_194638
Lipid biosynthesis proteins [BR:ehx01004]
 Desaturase
  First
   EMIHUDRAFT_194638
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 17287256
NCBI-ProteinID: XP_005794415
JGI: Emihu1_194638
UniProt: R1G1U4
Position
Unknown
AA seq 164 aa AA seqDB search
MVLAALYGSSLSRANTEESSLDTLTKTTIPYKDQERKCSSFPPPLKDIRFTMATYITLTQ
LLGFAGIFFVATIWWAFILWPITGFGITGGAHRLWAHRSYKASFAYRFVVMLVNSCANQG
TIFHWARDHRTHHFHSETVADPHDAIRGFWFAHMGWLYLKKDPR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgccgccctctacggcagctcgctctcgcgcgccaacaccgaggagagctcg
ctcgacaccctgacaaagaccaccatcccgtacaaggaccaggagcgcaaatgctcctcg
ttccctccgccgctgaaggacatccgcttcacgatggccacgtacatcacactgacgcag
ctgcttggctttgcgggcatcttcttcgtcgccaccatctggtgggccttcatcctctgg
ccaatcaccggctttggcatcaccggcggcgcgcaccggctgtgggcgcaccgcagctac
aaggcgtccttcgcctaccgcttcgtcgtgatgctggtcaactcgtgcgccaaccagggc
accattttccactgggcgcgcgaccaccgcacgcaccacttccactcggagacggtggcc
gacccgcacgacgcgatccgcgggttttggtttgcgcacatggggtggctgtacctcaaa
aaggacccgcgc

DBGET integrated database retrieval system