KEGG   Emiliania huxleyi: EMIHUDRAFT_196115Help
Entry
EMIHUDRAFT_196115 CDS       T02915                                 

Definition
putative arginine kinase
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
ehx  Emiliania huxleyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EMIHUDRAFT_196115
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     EMIHUDRAFT_196115
Exosome [BR:ehx04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   EMIHUDRAFT_196115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 415 aa AA seqDB search
MGGGASKAKKQATASEVVPEASAAAANAGTSSKIEELTAQAKVAAEANPDNLCAKTLLEA
EVQTWMATLPAAKLDELALCAKSGLDNHDSGLGCYAVDPANYDELAPFFDRVCEGYHHGG
GKVHTTNWSLDGVEGLPEDGQLDLQKLGLGKELSMRVRVGRNLTAFPLPGLMTKADRVNF
EKTMLKAFDVLKANPDYGGNVFSMTPNDVWSEVTGEAENPNLISADKYQELVDAHVMFKD
MAADPYLASAGIASDWPCGRGCYQSADGGFIIWFGEEDQLRIMCMAKGFVLNAVFDRLHT
ALQAVEAIDGIAFATSTKYGYVTSCPSNLGTGMRASVHVAVPNLTSDGTDAKAKAAAKPL
GLSVRGMGGEHTPIGKDGTIDLSPSSRLFITEAEIVTKLYNGIKLLLEKEAEAQE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtggggcgagcaaggcgaagaagcaagccaccgcgtcggaggtggtgcccgag
gcttccgcggcggcggccaatgccggcacgagctccaagattgaggagctcaccgcccag
gccaaggtggcggccgaggccaaccccgacaacctgtgcgcaaagacgctgctcgaggcc
gaggtgcagacgtggatggccacgctgcccgcggccaagctcgacgagctcgcgctgtgc
gcaaagtcgggcctcgacaaccacgactcgggcctcggctgctacgccgtcgacccagcc
aactacgatgagctcgcgcccttctttgaccgcgtctgcgagggctaccaccacggcggc
ggcaaggtgcacaccaccaactggtcgctcgacggcgtcgagggcctcccggaggacggc
cagctcgacctgcaaaagctcgggctgggcaaggagctctcgatgcgcgtgcgcgtcggg
cgcaacctgaccgccttcccactgccgggcctgatgaccaaggccgaccgcgtcaacttc
gagaagacgatgctcaaggccttcgacgtgctcaaggccaaccccgactatggcggcaac
gtcttcagcatgacgcccaacgacgtgtggagcgaggtgacgggcgaggcggagaacccg
aacctcatctcggcggacaagtaccaggagctggtcgatgcgcacgtcatgttcaaggac
atggccgccgacccatacctcgcctccgccggcatcgcgtcggactggccgtgcgggcgg
ggctgctaccagtcggccgacggcgggttcatcatctggttcggcgaggaggaccagctg
cgcatcatgtgcatggccaagggcttcgtgctcaacgccgtcttcgaccggctgcacacc
gcgctccaggccgtcgaggcgatcgacggcatcgccttcgccacgtcgaccaagtacggc
tacgtgacgtcgtgcccgtccaacctgggcacggggatgcgcgcctcggtgcacgtggcg
gtgcccaacctgacctcggacggcaccgacgccaaggccaaggcggcggccaagccactc
ggcctgtcggtgcgcggcatgggaggcgagcacacgccgatcggcaaggacggcacgatc
gacctgtcgccgagcagccgtctcttcatcaccgaggcggagatcgtgaccaagctgtac
aacggcatcaagctgctgctggagaaggaggcggaggctcaagagtag

DBGET integrated database retrieval system