KEGG   Emiliania huxleyi: EMIHUDRAFT_206956Help
Entry
EMIHUDRAFT_206956 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ehx  Emiliania huxleyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EMIHUDRAFT_206956
Enzymes [BR:ehx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EMIHUDRAFT_206956
Exosome [BR:ehx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EMIHUDRAFT_206956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 608 aa AA seqDB search
MRNRPYPVLKCSILLAAHDRYSPHELYSTDGTEAGFKAGDSRLSGNENMWRGDQFEPATR
RRERSLNFKPNKATGEEGFLGLAANAETALQTVKDKVLAEEVAGEALDSLCAEGGVGGGD
GQCHPSEGSAEGLRHFCVERGLRHFGLHRDAVGWRFREWAPSAAAASLVGDFNGWDVTAH
PCEEVGGGVWEALVRDDDTTLLAPLRVGARFKVQQDPSSYEVCALVPRSLGGFAWQHARP
SRPPGSLRVYEVHVGIATAREEEHGYYASFGYQAGTFVSPQRLTVAASVHQALVDAAHGR
GLLVLGEMVLAHSALVRREGLPQHAGGGPYFLPGEAGHHPGWGSRLFDYSRTEVLRLLLA
TIAHFAEAYRLDGFRLDAASTVLYRHRCLGLSPAHFCGARYEVASRCGLTFVMLANLLAK
RALQPPLLTVAEESSGYPGLCAPTHAWGAGFDYRMAMGIPDLWGRELALAHAPADAPLPV
CDERRLAYAECHDQSLVGDQALAFRLMGAAMYDGMSAGAPPSPAVARGVALHKVSRLLTY
ALAADAYLNFVGNEFGHPEFLADDPGLRYAQLLAFDRAMHAAEASLRWLSSPPPTRGDEA
RRSPRPSP
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatcgaccctatccagtgctcaagtgctcaattctactcgctgcgcacgaccgc
tactcgccgcacgagctctactcgaccgacggcaccgaggcggggttcaaggcgggcgac
tctcggctctcgggcaacgagaacatgtggcggggagaccagttcgagccagcgacgcgg
cggcgtgagcgatcgctcaactttaagccgaacaaggcgacgggcgaggagggcttcctc
gggctggcggccaacgcggagacggcgctgcagacggtgaaggacaaggtgctggcggag
gaggtggcgggcgaggcgctcgactcgctctgtgccgagggtggcgtcggtggcggtgac
ggccagtgtcatccctctgagggctccgcggaagggctgcggcacttctgcgtggagcga
gggctgcggcacttcggcctgcatcgcgacgcggtcggctggcgctttcgcgagtgggcg
ccctcggctgccgccgcgtcgctcgtcggtgacttcaacggatgggacgtgacggcgcac
ccgtgcgaggaggtcggcggaggggtgtgggaggccttggtgagggacgatgacacgacg
ctgctcgcgccgctccgcgtcggcgcgaggttcaaggtgcagcaggacccgtcttcgtac
gaggtctgcgcgctggtgccgcgcagcctcggcggctttgcgtggcagcacgcccgcccg
tcgcggccgcccggctcgctgcgcgtgtacgaggtgcacgtggggatcgccaccgcgcgg
gaggaggagcacggctactacgcctcgttcgggtaccaggccggtacttttgtgtcgcct
cagcggctgaccgtcgccgcttccgttcaccaggcgctcgtcgacgcggcgcacgggagg
gggctcctcgtgctcggggagatggtcctcgcgcactcggcactcgtccgccgggagggc
ttgccgcagcacgcaggcggagggccctacttcctgcccggcgaggcaggccaccacccg
ggctggggctcgcgcctcttcgactactctcgcaccgaggtgctgcgtctcctcctcgcc
accatcgcccacttcgcagaagcgtaccgcctcgacggcttccgcctcgacgcggcctcg
actgtcctgtaccgccaccgctgcctcggcctctctccggcccacttttgcggcgcgcgc
tacgaggtcgcatcgcgatgcgggctcacctttgtgatgctcgcgaacctgctcgccaag
cgcgcgctgcagccgcccctcctcaccgtcgccgaagagagctccggctaccccggcctc
tgcgcgccgacgcacgcctggggcgccggcttcgactaccgcatggcgatgggcatcccg
gacctgtggggccgcgagctggcgctggcgcacgcgcccgccgacgcgcccctccccgtg
tgcgacgagcggaggctcgcctacgccgagtgccacgaccagtcgctcgtcggggaccag
gcgctcgcgtttcgcctgatgggcgcggccatgtacgacggcatgtcggcaggcgcaccg
ccgagccccgccgtggcacgcggcgtcgcgctgcacaaggtctctcggctgctcacctac
gcgctcgccgccgacgcgtacctcaactttgtcggcaacgagtttggccaccccgagttc
ctcgccgacgaccccggcctgcgctacgcgcagctcctcgcctttgaccgagcgatgcac
gccgccgaggcgtcgctgcggtggctctcctcgccgccgccgacccgcggcgacgaggcg
cggcgctctccacgcccgagcccgtga

DBGET integrated database retrieval system