KEGG   Emiliania huxleyi: EMIHUDRAFT_216454Help
Entry
EMIHUDRAFT_216454 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ehx  Emiliania huxleyi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EMIHUDRAFT_216454
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EMIHUDRAFT_216454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 315 aa AA seqDB search
MHGAGTVMLSCLTLASAISPTLLLHVGAPLRVAFGSCRKQLKPQPVWDAVAAQSPALWLW
LGDAMYPKGSVTSAAQLREAYAQAGEPALRGVPVDGVYDDHDYGLNDGGVGWELKEDARQ
LFLDEVVGAPADSARRTQRGGLYGSRTLGEPPRQLKVVMLRHTGVTARADSFILNQGSSH
SAQVLDEEQWAWLRTQLTNSTASAHLIVSSASCEPSAPPSSPTGCGAIVVRIHHALDGGT
ALEHSLPLGLTAGQEAERWRAAQALPTIFDAAAELRAAVAALAGGALAAGLLCCCGCRRL
ARGRGRAAQRQSKRD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcgccggcacggtcatgctctcctgcctcacccttgcctccgccatcagcccg
acccttctactgcacgtcggcgcaccactgcgcgtggcgttcggctcctgccggaagcag
ctcaagcctcagcctgtgtgggacgccgtcgccgcgcagtcgccggcgctgtggctgtgg
ctgggcgatgccatgtacccgaaagggtcggtgacatctgccgcgcagctgcgtgaggcg
tacgcgcaggcgggcgagccggcgctgcgcggcgtgccggtcgacggcgtatacgacgat
cacgactacgggctgaacgacggcggcgttggctgggagctgaaggaggacgcgcggcag
ctcttcctcgacgaggttgtcggcgcgcccgctgactcggcgcggcgcacccagagagga
ggcctctacggcagccgcacgctcggcgagccgccccggcagctcaaggtggtgatgctt
cgacacacaggagtcactgctcgtgctgactcattcattcttaaccaaggcagctcgcac
tccgcgcaagtgctggacgaggagcagtgggcgtggctccggacccagctcaccaactcg
accgcgtcggcgcacctcatcgtctcgtcagctagctgcgagccgtcggctcctccttcg
tcacccacgggctgcggcgccatcgtcgtccgtatccaccacgcgctcgacggcggcacg
gcgctcgagcactctctgccgctcgggctgaccgccgggcaagaggcggagcgctggcgc
gcagcgcaggccctcccgaccatctttgacgccgcggcggagctgcgcgcagccgtggcc
gccctcgccggcggcgctctcgcggccggcttgctctgctgttgcgggtgtaggaggttg
gcgcggggccggggtcgcgccgcgcagaggcaaagcaagcgagactga

DBGET integrated database retrieval system