KEGG   Emiliania huxleyi: EMIHUDRAFT_222774Help
Entry
EMIHUDRAFT_222774 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ehx  Emiliania huxleyi
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    EMIHUDRAFT_222774
Enzymes [BR:ehx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     EMIHUDRAFT_222774
Glycosyltransferases [BR:ehx01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   EMIHUDRAFT_222774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 441 aa AA seqDB search
MPSAKSRRPAGPRPDDRGSVIGGDASCLFLLTLAAGVTRLWRIDLPATPVYDETHVGRFL
NWRAASAVPKRSPSNPPSQIRLLARLPPRYHQRAYFFDVHPPLAKLAMYRVALALGFRGA
ASCPYESTEPFAAECDLAPQRLLPALCGTAMVPVAFITARAAGLSRASSLLAAYLVLSDN
LFLALSRLHLNDIILALLCKYGAPLTTLGWLGLQNLLLLCRLAAQGRSVAALLRQAAARG
AILLGLPLAMHVAMLRLHLSLLPNSGDGDGYMSEGFQATLAGNPLAASLPPGERPSFLAL
ALEHAATQFRYNRNMAILFPRGSHAFDSRWYSWPLAARGVHFSLDRQTFLLYYAPAYYFA
ILIAAAGWDALVVRARSVPRRVGWALTAAAAAFFGSFTARLWRLAVGAPATPHEWHAMLR
LASTECWAEQWLGETCWASQT
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgcgaaatcccgccgccctgctggcccgcgccccgacgaccgcggcagcgtg
atcggcggcgacgcgagctgtctcttcctactgacactcgcagccggtgtgacccggctc
tggcgaatcgaccttcccgccacgccggtgtacgacgagacgcatgtgggtcgcttcctc
aactggcgcgccgcttctgccgttcccaagcgcagcccatctaatccgccatctcaaatc
cgactcctcgcgcgtctgcctccaaggtaccaccagcgcgcctacttcttcgacgtgcat
cccccgctagcaaagctcgccatgtaccgcgtcgcgctcgccctgggcttccgcggcgcc
gcctcctgtccgtacgagtcgaccgagccgtttgcggccgagtgcgacctcgcgcctcag
cggctgctgccggcactgtgcggcacggcgatggtgccggtcgcctttatcactgcgcgc
gccgccgggctctcgcgtgcgtcgagcctgctcgccgcctacctcgtgctgagcgacaac
ctcttcctcgccctctcgcgcctccacctcaacgatatcatcctcgccctcctctgcaag
tacggcgcgcccctcaccaccctcggctggctcgggctgcagaatctgctccttctctgc
cggctcgccgcgcaggggcgaagcgtcgcggcgctcctccggcaggcggcggcgcgcggc
gcgattctgctcgggctgccgctggcgatgcacgtggcgatgctccgcctccacctctcc
ctgctccccaactctggcgacggcgacggctacatgtccgaaggcttccaggccacgctc
gccggcaacccgctcgccgcttcgcttccgcctggagagaggccctccttcctcgcgctc
gcgctcgagcacgccgccacccagttccgctacaaccgcaacatggccatcctcttcccg
cgcggctcgcacgccttcgactcgcgctggtactcgtggccgctcgccgcgcgaggcgtc
cacttctccctcgaccggcagaccttcctcctctactacgcgcccgcctactacttcgcc
atcctgatcgccgccgccggctgggacgcactcgtcgtccgcgcgcgctccgtgccccgc
cgggtcggttgggcgctcaccgccgccgccgccgcattcttcggctccttcaccgcgcgt
ctctggcggctcgccgtcggcgcgcccgccactccgcacgagtggcacgcgatgctccgc
cttgcgtcgacagagtgctgggcggagcagtggctcggggagacgtgctgggcgagccag
acgtga

DBGET integrated database retrieval system