KEGG   Emiliania huxleyi: EMIHUDRAFT_244346Help
Entry
EMIHUDRAFT_244346 CDS       T02915                                 

Definition
monoamine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
ehx  Emiliania huxleyi
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EMIHUDRAFT_244346
   00330 Arginine and proline metabolism
    EMIHUDRAFT_244346
   00340 Histidine metabolism
    EMIHUDRAFT_244346
   00350 Tyrosine metabolism
    EMIHUDRAFT_244346
   00360 Phenylalanine metabolism
    EMIHUDRAFT_244346
   00380 Tryptophan metabolism
    EMIHUDRAFT_244346
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     EMIHUDRAFT_244346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 293 aa AA seqDB search
MVFGAHPDRISMLFFLSYVKAAGGLVQLLETRGAAQDSTLRGGAQQLSERLRGAVEAAGG
EVRLGAQAERVVAVGPSGSLLGVECRGGGPTLRARAVVVALSPKVALESICFEPRLPERR
RQLVGQLALGAKFVLVYETAWWRGGGLSGSSICSDASEEWPIFATFDYVHEAHGEQRRLH
ACVGRMLASGRDSEAAARPPQCVEFLERQWSEDGFARGCPVDLVPAGLQPAGPPSWNVAL
ARPCEARLFFASTDTATSWTGYMEGAVQAGGRAAKESISTARCSFPWMAAARS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcggcgcccatcccgacaggatcagcatgctcttcttcctctcgtacgtcaag
gcggcgggcgggctggtgcagctcctcgagacccgcggcgcggcgcaggactcgaccctg
cggggcggggcgcagcagctcagcgagcggctccgcggggcggtcgaggcggcgggtggg
gaggttcgcctcggagcgcaggccgagcgagtcgtggccgtcggtcccagcggctcgctc
ctcggggtggagtgccgcggcggcggcccgaccctccgagcccgggccgtcgtggtcgcg
ctctctcccaaggttgcgctcgagagcatttgcttcgagccccgcctccccgagcgccgg
cggcagctcgtcgggcagctcgcgcttggcgccaagttcgtcctcgtctacgagacggcg
tggtggcgcggcggcggcctctcgggcagcagcatctgctccgacgcgagcgaggagtgg
cccatcttcgccacgttcgactacgtgcacgaggcgcacggcgagcagcggcgactgcac
gcgtgcgtcggccgcatgcttgcgagcgggcgcgacagcgaggcggcggcgcgccccccg
cagtgcgtcgagttcctcgagaggcagtggagcgaggacggcttcgcgcgcggctgcccc
gtcgacctcgtccccgccgggctgcagccggccggcccgccctcctggaacgtcgcgctg
gcgcggccgtgcgaggcacgcctcttcttcgcgtccacggacacggcgacgagctggacg
gggtacatggagggcgcagtgcaggccggcgggcgcgccgcgaaggagtcaatttccacc
gcacgctgcagcttcccttggatggccgccgcacgttcgtga

DBGET integrated database retrieval system