KEGG   Emiliania huxleyi: EMIHUDRAFT_249435Help
Entry
EMIHUDRAFT_249435 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ehx  Emiliania huxleyi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EMIHUDRAFT_249435
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EMIHUDRAFT_249435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 505 aa AA seqDB search
MTAARVGTVVVDGEVVPHNLELQQPDLRAAAGAPAAREVFVRKACPAGRPAAAITCSFGI
VAAALAYTLFYLIAAPPPLPVAAPLPSADRVLTRVVHGSCSKQTLPQPFWRTVGSLAPDL
FVYNGDIVYGDCADVARPHEAWSEPACEELRTAWADLFAHEEFTSARAVTPVIGMPDDHD
YGLNDCGASNPYKQTAKDLFLERFGAAEDDPRRSRGGLYTSHAFGAAPNRTQVILLDTRW
FRSELKRDSGAAHGRYAPYTEAEAEAGRLTMLGEEQWAWLEARLREPADLRLVFSTVQVL
STAHGWERWGLIPTEVRRLRRLIRSSAARGVVFLSGDRHVGGVYVQPAAAGLNPYPLYEA
TASSLTHTVPPSLATGDEPPHEPDADLSSSARRLGALLHLNHVGSVDVDWEARAVTLRLI
TDDTCAAPAWEGCQQGGSTAGATERSVTLRLDVDLAPPPECGRPCATPLNPAATCAAFEG
LFSCAGSSELLGCNCTGCCAGEGEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgcgcgagtcgggaccgtcgtcgtcgacggcgaggtcgtgccgcacaacttg
gagctccagcagccagacctgcgagccgcggccggagcgccggcagctcgagaggttttt
gtgcggaaggcgtgtcctgccggccgaccggccgcagccatcacctgctcctttgggatc
gtcgccgctgctctcgcgtacacgctcttctacctgattgctgcgccgccgccgctgccc
gtggcagcgccgctcccgtcggcagacagggtgctgacgcgggtcgtgcacggctcgtgc
tcgaagcagacgctgccgcagcccttctggcgcaccgtggggtcgctcgcgcccgacctc
ttcgtttacaacggcgacatcgtgtacggcgactgcgccgacgtcgcgcggccgcacgag
gcgtggagcgagccggcgtgcgaggagctgcgcactgcgtgggcggacctgttcgcccac
gaggagtttacgagcgcgcgggcggtgacgccggtgatcggcatgccggacgaccacgac
tacgggctcaacgactgcggcgcgtcgaacccgtacaagcagaccgccaaggatctcttc
ctcgagcggttcggcgcggcggaggacgacccgcggcgctcgcggggcgggctttacacg
tcgcacgccttcggagcggcgcccaaccggacgcaggtcattttgctcgacacgcgctgg
ttccgctccgagctcaagcgcgacagcggcgcggcgcacgggcggtacgcgccctacacg
gaggcggaggcggaggcggggcggctcaccatgcttggcgaggagcagtgggcttggctc
gaggcgcggctgcgggagcctgcggatctgcggctcgtgttctcgacggtgcaggtgctc
tcgacggcgcacggctgggagcggtggggactgatccccacggaggtgcgccggctgcgc
cggctgatccgctcctctgccgcgcgcggcgtcgtctttctttccggggaccggcacgtg
ggaggcgtatacgtgcagccggccgcggcgggcctcaacccgtaccctctctacgaggcg
acggcgtcctccctcacccacaccgtcccgccctccctcgccacgggcgacgagcctccg
cacgagccggacgccgacctctcctcttcggcccggcggctcggcgcgcttctccacctg
aaccatgtcggcagcgtcgacgtggactgggaggcccgcgccgtcacgctgcgcctcatc
actgacgacacgtgcgctgcgccggcgtgggagggctgccagcaggggggcagcaccgcc
ggcgcaacggaacggtcggtgacgctgcgactcgacgtcgacctcgcacccccgcccgag
tgcggccgcccgtgcgccacgccgctcaacccggcggcgacgtgcgccgctttcgagggc
ctcttctcctgcgccggcagcagcgagctgctcggctgcaactgcacgggctgctgcgcc
ggcgagggggagctgtag

DBGET integrated database retrieval system