KEGG   Emiliania huxleyi: EMIHUDRAFT_251454Help
Entry
EMIHUDRAFT_251454 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ehx  Emiliania huxleyi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EMIHUDRAFT_251454
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EMIHUDRAFT_251454
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EMIHUDRAFT_251454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 170 aa AA seqDB search
MIQAAQREVAQRGGGALTMFASPWSPPAWMKIPLLPPTGARGPAPSGISIARWWEADPKG
KRSMILSDVPLCLEAESLGPWAKYFSLWIDAYQRHGIRIWAVTIQNEPMAAVGWESCLWS
ANNSAAFVRDHLGPVLAREQPGVLIIGYDHNKDKVAKWAKALYEDPLAAQ
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggccgcacagcgtgaggttgcgcagcgcggcggaggagctctgactatgttt
gcctctccgtggtcgcctccggcgtggatgaagattccactcctccctcccacgggcgct
cgggggccggcgccctctgggatctcgattgcgcgctggtgggaggccgaccccaaaggc
aagcggagcatgattctctcggacgtgccgctctgccttgaagcggagagtctgggcccc
tgggcaaagtacttttcgctctggatcgatgcgtaccagcggcacggcatccgaatctgg
gccgtgacgattcagaacgagcccatggctgccgtcggttgggagtcgtgcctttggagt
gccaacaattcggcagcgtttgtgcgggaccatctcgggccggtgctcgctcgagagcag
cccggagtgttgatcataggctacgatcacaacaaggacaaggtcgcgaagtgggcaaag
gcgctatacgaggacccgctagcagcgcagtag

DBGET integrated database retrieval system