KEGG   Emiliania huxleyi: EMIHUDRAFT_365731Help
Entry
EMIHUDRAFT_365731 CDS       T02915                                 

Definition
putative histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EMIHUDRAFT_365731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 327 aa AA seqDB search
MKRRIDDMNALQAGASHDEALEKEHEESTKVKNIQTVEIGRFEVDTWYFSPFPDEYAQQR
KLYICEFTLKYMKRRSTYLAHCEREQSRQPPGQLIYRCDAPPLRRECLAAGMEQPKQLSV
FEINGSDSKVYCQCLCLLAKLFLDHKTLYYDVDPFLFYVLCEVGADGGHRIAGYFSKEKT
SSEHNNIACILVLPQHQRKGYSKLLIDCAYQISIREAKVGSPEKPLSDLGLLSFRSYWTQ
ILLQTLSDHRGNLSVKEISMMTSITTDDIISTLQSLNLIKYWKGQHVISVSPKIVDEHLK
LHPPGTSLRCDPSKLTWQPPAEDALDK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcggatcgacgacatgaatgcgctgcaggccggcgcgtcgcacgacgaggcg
ctcgagaaggagcacgaggagtcgacaaaggtcaagaacatccagacggtcgagatcggc
cgcttcgaggtggacacgtggtacttttcgcccttccccgacgagtacgcgcagcagcgc
aagctctacatctgcgagttcacgctcaagtacatgaagcggcgcagcacctaccttgcg
cactgcgagcgcgagcagtcacgccagccgcccggccagctcatttaccgctgcgacgcg
ccgccgctgcggcgcgagtgcctcgcggcgggcatggagcagccgaagcagctgtccgtc
ttcgagatcaacggctccgactcgaaggtgtactgccagtgcctctgcctgctcgcaaag
ctcttcctcgaccacaagaccctctactacgacgtggaccccttcctcttttacgtgctc
tgcgaggttggcgccgacggcggccaccggatcgcgggctacttctccaaggagaagacg
tcgagcgagcacaacaacatcgcgtgcatcctcgtcctcccgcagcaccagcgcaagggc
tactccaagctcctcatcgactgcgcctaccagatctcgatccgcgaggccaaagtcggc
tcgcccgagaagccgctctcggacctcgggctgctctccttccgctcctactggacgcag
atcctgctgcagacgctgagcgaccaccgcggcaacctctccgtcaaggagatctcgatg
atgacctccatcaccacggacgacatcatctcgaccctccagtcgctcaacctgatcaag
tactggaaggggcagcacgtcatctccgtctcgccaaagattgtcgacgagcacctcaag
ctccacccgcccggcacctctttgcgctgcgacccgtccaagctcacctggcagccgccc
gccgaagacgccctcgacaagtga

DBGET integrated database retrieval system