KEGG   Emiliania huxleyi: EMIHUDRAFT_427068Help
Entry
EMIHUDRAFT_427068 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EMIHUDRAFT_427068
Transcription machinery [BR:ehx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EMIHUDRAFT_427068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 357 aa AA seqDB search
MASAELAVDNKSDQTPLARERQHAQDEREGRLRFVVVKNDGLDRSLISLIDMKSIYSKQL
PKMGKEYIVRLVLDRSHTSLACVFEGEIVGGVTYRRHATQAFAEIAFCAVSATHQVRGYG
TRLMNQLKEHCKREGIHFLLTYADNHAIGYFRKQGFQKQVTMKRERWLGYIKDYDGGTLM
ECAIDTQVDYLNIRFVAEEQRRAIAERMEAGGAQQQEAEYAGYDPAEGGVPAGLQGTSWR
ESALHCSMQGKPVPLADCLQAVLAEVATHADAWPFQTAVSTSLAPDYYEVIKDPVDLASV
RARLTPRAHLHTTPRSTSSSPTCCACAKTAACTTATTTSTTTARSGWRRSSGRRSER
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggcagagctcgcggtcgacaacaagtcggaccagacgccgctggcgcgagag
cggcagcacgcgcaggacgagcgtgagggccgtctgcgcttcgtcgtcgtcaagaacgac
ggcctcgaccgctcgctcatctcactgatcgacatgaagagcatctattcgaagcagctg
ccaaaaatggggaaggagtacatcgtacggctcgtcctcgaccgctcgcacacctcgctc
gcctgcgtctttgagggcgagatcgtgggcggcgtcacttaccggaggcacgcgacgcag
gcgtttgcagagatcgccttctgcgccgtctcggcgacgcaccaggtgcgcgggtacggc
acgcggctgatgaaccagctcaaggagcactgcaagcgcgaggggatccactttcttctc
acgtacgccgacaaccacgcgattggctacttccgcaagcagggcttccaaaagcaggtg
acgatgaagcgcgagcggtggctgggctacatcaaggactacgacggaggcacgttgatg
gagtgcgccatcgacacgcaggtggactacctcaacatccgcttcgtcgccgaggagcag
cgccgcgcgatcgcggagcggatggaggcgggcggcgcgcagcagcaggaggcggagtac
gcggggtacgacccggcggagggaggggtgccggccgggctgcaggggacgtcctggcgg
gagagcgcgctgcactgctccatgcaaggcaagccagtcccgctcgccgactgcctgcag
gccgtgcttgcagaggttgccacacacgcagacgcatggcccttccagacggccgtctcc
acctcgctcgcgccggactactacgaggtgatcaaggacccggtggacttggcgtcggtg
cgggcgaggctcacgccgcgggcgcacctccacactacacctcgctcgaccagttcctcg
ccgacctgctgcgcatgtgcgaaaactgccgcgtgtacaacggcgacaacaacgagtact
acgactgcgcggtccggctggaggcgttcgtccggaagaaggtcggagaggtga

DBGET integrated database retrieval system