KEGG   Emiliania huxleyi: EMIHUDRAFT_434183Help
Entry
EMIHUDRAFT_434183 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EMIHUDRAFT_434183
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     EMIHUDRAFT_434183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Rieske Rieske_2
Motif
Other DBs
NCBI-GeneID: 17277318
NCBI-ProteinID: XP_005784475
JGI: Emihu1_434183
UniProt: R1F9I4
Position
Unknown
AA seq 373 aa AA seqDB search
MSNSCPHKKASLHRSGDIEDLGGDLGLCLRCPKHKSKFGGGLFVSFATGKCTTRRQCSRS
DDVAAWAVPTYQTKEEDGVIFVRRLAEHAAPEPAPAAPTRAAADEQHARLLAAKLLRIRA
LSPDSDEYTLQLVEERDRAAFAQEPAAMWHLWLAMGGVSREYTPTSTSEDTTRSGLITLV
IKLYSKGEMSDQLARAAIGDLAAVSPPRVTLRIPAFDLAPTPRGLTFNLLAGGTGVAPCL
QFLRRAKAAAACVQMLYSCWTLEDALLAAELEDLAASWPERGFRYAYVLTREKDRAVLVD
AREPKRSRTGGAAAVRGRRIDAAMMREHLVDRRQDAVVMTVVSGPSGFNARCEELVRRNL
TPEERGEVVVLDA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagctgcccgcacaagaaggccagtctgcaccgctctggcgacattgaggac
ctcggcggagaccttgggctctgtttgcgatgcccgaagcacaaaagcaagttcggtggg
ggcctctttgtttctttcgccaccggcaaatgcacgacccgccgccaatgcagtcgctcg
gacgacgtggcggcatgggcggttccgacttaccagacaaaggaggaggacggtgtgatc
ttcgttcgcaggctcgcggagcacgctgcaccagagcctgcgccggccgcgcctacgaga
gccgcggctgatgagcagcatgccaggctgctggctgccaagctgctccgaatccgcgcc
ctgagccccgacagcgacgagtacactctgcagctggttgaggaacgggaccgtgccgcc
tttgcgcaggagccggcggccatgtggcacctctggctggccatggggggagtaagccgc
gagtacaccccgacgagcaccagcgaggacacaacgcggagcgggctgatcaccctggtc
atcaagctgtactccaagggtgagatgtcggaccaactcgcgagggcggcgattggagac
ctagccgcagttagtccgccgagggtgacgctgaggatcccagcattcgatctcgctccg
acaccgcgcgggctgaccttcaatctgttggctggcgggactggcgtcgcgccgtgcttg
cagttcctgcgccgggccaaggcggcagcggcgtgcgtgcaaatgctctactcgtgctgg
acgctggaggatgcgctgctggcggctgagctggaggatctcgccgcctcctggcccgag
cggggcttccgctacgcgtacgtgctcacgagggagaaggacagggcagtgctagtagat
gcgagggagcccaagcggagccggaccggcggcgccgctgctgtccgcggccggcgtatt
gacgcggcgatgatgcgtgagcacctggtggatcgacgacaggacgcagtggtgatgacc
gttgtcagcggcccgtcggggttcaacgcacgctgcgaggagttggtgcgccgcaacctg
acgccggaggagcgaggagaagttgtcgtgctggatgcctga

DBGET integrated database retrieval system