KEGG   Emiliania huxleyi: EMIHUDRAFT_447795Help
Entry
EMIHUDRAFT_447795 CDS       T02915                                 

Definition
alanine aminotransferase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ehx  Emiliania huxleyi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ehx01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ehx01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ehx01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ehx00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 541 aa AA seqDB search
MRQALRPAAQTARPVAQTARPLALRRRLSTLHGGADALRKPYPPSHVLTLGEINPNVLSA
QYAVRGELVQRAAAIKEEMAAGSANVPFKKVLECNIGNPQAVGQSPIGFNRQVLSLMVCP
ALLDQPGVDALFAPDAIARATRLARAKEYLAAIPSGVGAYSDSQGFRIVREQVADFISSR
DGLPASPEDIFLTDGASKGVGFLLSLILRGGGSDGLLVPIPQYPLYSATLALQETHMLGY
ELDEAAGWSLPISLLEAELEDAQAKGVATRALVVINPGGQRPAAGNPTGNSLPYDNMVEC
IDFCAKHGLVLMADEVYQENIWDGGRPFHSFKKVLMEMSPRPNLQLVSFHSTSKGFLGEC
GLRGGYFEIVGFDPEVKAQLLKLISIGLCSNTLGPDRSGQIATGLMVQPPRPGDASYEIY
SGERDAILASMKRRATMLVDGLNALEGVTCNQPQGAMYAFPSITLPPKAIAAAKDAGKVP
DTFYALALLEATGIVVVPGSGFGQKEGTWHFRTTFLPPESEMTDVVDRMTAFHADFMGKY
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggcgcttcgtcctgcggcgcagactgcgcggcctgtggcgcagactgcgcgt
ccgctcgcgctgcgccgtcgactttccactctccatgggggcgcggacgcccttcgcaag
ccgtacccgccgtcgcacgtgctcacgctcggcgagatcaacccgaacgtgctctcggca
cagtacgcggtgcgcggcgagctggtgcagcgcgcagcggcgatcaaggaggagatggcg
gcgggcagcgccaacgtgcccttcaagaaggtcctcgagtgcaacatcggcaacccgcag
gcggtcggtcagtctcccatcggcttcaacaggcaggtgctctcgctgatggtctgcccg
gcgctgctcgaccagccgggtgtcgacgcgctgtttgcgcccgacgcaatcgcgcgcgcc
acgcgcctcgcgcgcgccaaggagtacctggccgccatcccgtcgggtgtcggcgcgtac
tcggacagccagggcttccggatcgtccgggagcaggtggccgacttcatctcgtcgcgc
gacggcctccccgccagccccgaggacatcttcctgaccgacggcgcctccaagggcgtc
ggctttctgctctccctcatcttgcgcggcggcggctcggacgggctgctggtgcccatc
ccgcagtacccgctctactcggccacgctggcgctgcaggagacgcacatgctcgggtat
gagctcgacgaggctgcgggctggtcgctgccgatctcgctgctggaggcggagctggag
gatgcgcaggccaagggcgtggcgacgcgcgctctggtggtcatcaacccaggcggccaa
cggccggcagctggcaacccgacgggcaactcgctgccgtacgacaacatggtggagtgc
atcgacttttgcgcaaagcacgggctggtgctgatggcagacgaggtgtaccaggagaac
atctgggacggcggccgccccttccactccttcaaaaaggtgctgatggagatgagcccg
cggccaaacctgcagctcgtctccttccactcgacttcgaagggcttcctcggcgagtgc
ggtctgcgcggcggctactttgagatcgtcgggttcgaccccgaggtcaaggcgcagctg
ctcaagctcatctcgatcggcctctgctccaacaccctcggcccagaccgctccggccag
atcgccaccgggctaatggtgcagccgccgcggccgggcgacgcctcgtacgagatctac
tccggggagagggacgccatcctcgcctcgatgaagcgacgggcgacgatgctggtggac
gggctcaacgcgttggagggtgtcacgtgcaaccagccgcagggcgccatgtacgccttc
ccgtccatcacgctgccgccgaaggcgatcgcggcggccaaggacgccggcaaggttccc
gacaccttctacgctctcgcgctgctggaggcgacggggatcgtcgtggtgccgggcagc
ggctttgggcagaaggaaggcacgtggcacttccgcaccaccttcctgccgcccgagtcc
gagatgacggacgtggtggatcggatgacggccttccacgccgatttcatgggcaagtac
gcgtag

DBGET integrated database retrieval system