KEGG   Emiliania huxleyi: EMIHUDRAFT_447795Help
Entry
EMIHUDRAFT_447795 CDS       T02915                                 

Definition
alanine aminotransferase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ehx  Emiliania huxleyi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EMIHUDRAFT_447795
   01210 2-Oxocarboxylic acid metabolism
    EMIHUDRAFT_447795
   01230 Biosynthesis of amino acids
    EMIHUDRAFT_447795
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EMIHUDRAFT_447795
Enzymes [BR:ehx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EMIHUDRAFT_447795
Amino acid related enzymes [BR:ehx01007]
 Aminotransferase (transaminase)
  Class I
   EMIHUDRAFT_447795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 541 aa AA seqDB search
MRQALRPAAQTARPVAQTARPLALRRRLSTLHGGADALRKPYPPSHVLTLGEINPNVLSA
QYAVRGELVQRAAAIKEEMAAGSANVPFKKVLECNIGNPQAVGQSPIGFNRQVLSLMVCP
ALLDQPGVDALFAPDAIARATRLARAKEYLAAIPSGVGAYSDSQGFRIVREQVADFISSR
DGLPASPEDIFLTDGASKGVGFLLSLILRGGGSDGLLVPIPQYPLYSATLALQETHMLGY
ELDEAAGWSLPISLLEAELEDAQAKGVATRALVVINPGGQRPAAGNPTGNSLPYDNMVEC
IDFCAKHGLVLMADEVYQENIWDGGRPFHSFKKVLMEMSPRPNLQLVSFHSTSKGFLGEC
GLRGGYFEIVGFDPEVKAQLLKLISIGLCSNTLGPDRSGQIATGLMVQPPRPGDASYEIY
SGERDAILASMKRRATMLVDGLNALEGVTCNQPQGAMYAFPSITLPPKAIAAAKDAGKVP
DTFYALALLEATGIVVVPGSGFGQKEGTWHFRTTFLPPESEMTDVVDRMTAFHADFMGKY
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggcgcttcgtcctgcggcgcagactgcgcggcctgtggcgcagactgcgcgt
ccgctcgcgctgcgccgtcgactttccactctccatgggggcgcggacgcccttcgcaag
ccgtacccgccgtcgcacgtgctcacgctcggcgagatcaacccgaacgtgctctcggca
cagtacgcggtgcgcggcgagctggtgcagcgcgcagcggcgatcaaggaggagatggcg
gcgggcagcgccaacgtgcccttcaagaaggtcctcgagtgcaacatcggcaacccgcag
gcggtcggtcagtctcccatcggcttcaacaggcaggtgctctcgctgatggtctgcccg
gcgctgctcgaccagccgggtgtcgacgcgctgtttgcgcccgacgcaatcgcgcgcgcc
acgcgcctcgcgcgcgccaaggagtacctggccgccatcccgtcgggtgtcggcgcgtac
tcggacagccagggcttccggatcgtccgggagcaggtggccgacttcatctcgtcgcgc
gacggcctccccgccagccccgaggacatcttcctgaccgacggcgcctccaagggcgtc
ggctttctgctctccctcatcttgcgcggcggcggctcggacgggctgctggtgcccatc
ccgcagtacccgctctactcggccacgctggcgctgcaggagacgcacatgctcgggtat
gagctcgacgaggctgcgggctggtcgctgccgatctcgctgctggaggcggagctggag
gatgcgcaggccaagggcgtggcgacgcgcgctctggtggtcatcaacccaggcggccaa
cggccggcagctggcaacccgacgggcaactcgctgccgtacgacaacatggtggagtgc
atcgacttttgcgcaaagcacgggctggtgctgatggcagacgaggtgtaccaggagaac
atctgggacggcggccgccccttccactccttcaaaaaggtgctgatggagatgagcccg
cggccaaacctgcagctcgtctccttccactcgacttcgaagggcttcctcggcgagtgc
ggtctgcgcggcggctactttgagatcgtcgggttcgaccccgaggtcaaggcgcagctg
ctcaagctcatctcgatcggcctctgctccaacaccctcggcccagaccgctccggccag
atcgccaccgggctaatggtgcagccgccgcggccgggcgacgcctcgtacgagatctac
tccggggagagggacgccatcctcgcctcgatgaagcgacgggcgacgatgctggtggac
gggctcaacgcgttggagggtgtcacgtgcaaccagccgcagggcgccatgtacgccttc
ccgtccatcacgctgccgccgaaggcgatcgcggcggccaaggacgccggcaaggttccc
gacaccttctacgctctcgcgctgctggaggcgacggggatcgtcgtggtgccgggcagc
ggctttgggcagaaggaaggcacgtggcacttccgcaccaccttcctgccgcccgagtcc
gagatgacggacgtggtggatcggatgacggccttccacgccgatttcatgggcaagtac
gcgtag

DBGET integrated database retrieval system