KEGG   Emiliania huxleyi: EMIHUDRAFT_448114Help
Entry
EMIHUDRAFT_448114 CDS       T02915                                 

Definition
mitochondrial 4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ehx  Emiliania huxleyi
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ehx00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ehx00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ehx00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ehx00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ehx00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 518 aa AA seqDB search
MRRVLSSAPAAEMIGAAVAEKAAVRALSARAVSTAAAVATEEGGGISMKTKVPGPVGLRL
MEQHGPQGASGGAISLFCDYRASDGCYLVDADGNRMLDMFSQIASLPLGYNHPSLLAAQA
DPLLATYSTSRCAIGLMPPMELPELLDETFLKIAPAGLSRVQTMLCGSSANENVFKAAMF
AYRAKQRAKAGRGPTDFTRDELESCMVNQSPGCANDLSILSFRGGFHGRTMAALTCTHSK
PVHKLDAPAFDWPTADFPALQYPLEHHAAENAAEEARCVDGARAIFEARLAEGRPVVGFV
LEPTLRREDGEFDAAFIVDEVQTGVMASGHMWAHQAAWGLPEAPDFVVFSKKALLGGYYF
KEAFQPPQGRHVQRRSDTDPASHWPGPSLTAGYRIFNTWMGDMTKLLLFRAVLEAAEREG
LQARAVSTGAALMRTLEAARERHPRAVRNLRGAGTIIAFDCETPEMRDELAAALRNNGVL
VGTNGSQSIRFRPALIFGDEHVDEFEGVFAATLRQLAL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgtcctcagcagcgcgcctgctgccgagatgattggagccgcggtggcggag
aaggcggcggtgcgggcgctctctgcgcgggccgtgtccacagccgcggcggtggcgacg
gaggagggtggcggcatctcgatgaagaccaaggtgcccggtccggtcggcctgcgtctg
atggagcagcacggcccgcagggcgcgagcggcggtgcgatcagcctcttttgcgactac
cgcgcctcggacggctgctacctcgttgacgccgacgggaaccggatgctcgacatgttc
tcgcagatcgcgtcgctgccgctcgggtacaaccacccgagcctgctcgccgcgcaggcg
gacccgctgctcgccacctactccacctcgcgctgcgccatcggcctgatgccgccgatg
gagctgccggagctgctcgacgagacgttcctcaagatcgcgcccgccggcctcagccgc
gtgcagacgatgctctgcggctcgagcgccaacgagaacgtcttcaaggcggccatgttt
gcgtaccgcgcaaagcagcgcgccaaggccggccgaggtccgaccgacttcactcgcgac
gagctcgagtcgtgcatggtcaaccagtcccccggctgcgcgaacgacctctccatcctc
tccttccgcgggggcttccacggccgcaccatggccgccctgacatgcactcactccaag
ccggtccacaagctggacgcgcccgccttcgactggccgacggccgacttccccgctctc
cagtacccgctcgagcatcacgcggctgagaatgcggccgaggaggcgcggtgcgtggac
ggcgcacgcgccatcttcgaggcgcggctggccgagggccgacccgtcgtcggcttcgtc
ctcgagccgaccctccgccgtgaggatggtgagttcgacgccgcgtttatcgtggatgag
gtgcagacgggcgtgatggcgagcggccacatgtgggcgcaccaggcggcgtggggcctc
cccgaggcgcccgactttgtcgtcttcagcaagaaggcgctgctcggcggctactacttc
aaagaggccttccagccgccgcagggccgccacgtccagcggaggagcgacaccgacccg
gcttctcactggcctggtccctcgctcactgcaggataccgcatcttcaacacgtggatg
ggcgacatgacgaagctgctcctcttccgcgccgtcctcgaggcggcagagcgcgagggg
ctgcaagcgcgcgctgtgagcaccggtgcggcgctgatgcgcactctcgaggccgcgagg
gagcggcaccctcgcgcggtgcgcaacttgcgcggcgccggcaccatcatcgcctttgat
tgcgagacgcccgagatgcgcgacgagctcgccgccgcgttgcgaaacaacggcgtgctg
gtggggaccaacggctctcagtcgatccgcttccggcccgccctcatctttggcgacgag
cacgtcgacgagtttgagggcgtgtttgcggcgacgctgcggcagctcgcgctctga

DBGET integrated database retrieval system