KEGG   Emiliania huxleyi: EMIHUDRAFT_454338Help
Entry
EMIHUDRAFT_454338 CDS       T02915                                 

Gene name
Fpg1-2
Definition
putative formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ehx  Emiliania huxleyi
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    EMIHUDRAFT_454338 (Fpg1-2)
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     EMIHUDRAFT_454338 (Fpg1-2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     EMIHUDRAFT_454338 (Fpg1-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 394 aa AA seqDB search
MPELPEVEAQRSTIEAATLGRRIATLIAVEQGGGPREGQFDDKVIAEEVTPDVLAITLQD
RWVLGVRRRGKQLWLELGESKGGACCACLLIHMGMTGAVIVQGVAAPVYKSFAVDETAWP
PRFTKLELLMADAAGVSAPCVRLAFTDPRRFGRVLLRGADPFSRPPLSALAADPVTDPPS
AEAFASVLRRVRAPIKAALLDQGRVVCGVGNWVADEVLYQAGVLPAAPCESLSEEQLAAI
HAQVLAVCTAACGRLERGCDFPGQTSGSMASPLGRIHFDTVGGRTTAFVPARQVKGQAAG
KAGGEAKGKAGGRKGAACGGAAASGGAGSAAILAGGWATLTGLASRADLNGAQAQVLKRC
TGKATAGRWKVKAHSQRPGPLRLAVWAATLDESC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttccggaggtggaggcccagcgcagtaccatcgaggctgcgacgcttggg
cgccgcatcgccaccctgattgccgtggagcagggcggcgggccgcgtgaagggcagttc
gacgacaaggtgattgcagaggaagtcacgcccgacgtcctggccatcacgctgcaggat
cggtgggtgctcggcgtgcgtcgccgaggcaagcagctctggctggagctcggcgagagc
aagggcggcgcttgctgcgcgtgcctccttatccacatgggcatgaccggcgctgtgatc
gtgcagggcgtcgccgcccccgtctacaagtcattcgctgtcgacgagacggcgtggccg
cctcgcttcaccaagctggagctgctgatggccgatgcagcgggcgtctccgcgccctgc
gtccgcctggccttcaccgacccgcgtcgcttcgggcgggtgctgctccgaggcgccgac
ccgttctcccggccgccgctgagcgccctcgccgccgacccggtcacggacccgccgtcg
gctgaggcgttcgcgagcgtgctgcggcgggtgcgcgcgccgatcaaggccgcgctcctc
gaccaaggccgcgtcgtctgcggcgttggcaactgggtggctgacgaagtgctgtaccag
gcgggcgtgctgccggcggcgccctgcgagagcctctccgaggagcagctggcggcgatc
cacgcgcaggtgctcgccgtctgcactgccgcgtgcggccgcctcgagcgcggctgcgac
ttccccggccaaacgtcgggctcgatggcgtcgccgctcggccggatccactttgacacc
gtcggagggaggacgacggccttcgtgccggcccggcaggtaaaggggcaggcggcgggc
aaggcgggaggcgaggccaaaggcaaggcggggggcaggaagggggcggcgtgcggcggg
gccgcggcctcgggtggggcaggctcggctgccatcctggcgggcgggtgggcgacgctg
actggcctcgcgtcgcgcgccgacctcaacggcgcgcaggcgcaggtgctgaagcggtgc
accggcaaggcgacggctgggcggtggaaggtcaaggcgcactcgcagcgacctgggccg
ctccgcctcgcagtgtgggcggcgacccttgacgagtcttgctga

DBGET integrated database retrieval system