KEGG   Emiliania huxleyi: EMIHUDRAFT_463658Help
Entry
EMIHUDRAFT_463658 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00860  Porphyrin and chlorophyll metabolism
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EMIHUDRAFT_463658
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     EMIHUDRAFT_463658
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     EMIHUDRAFT_463658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 Pyr_redox_2 ApbA GIDA FAD_binding_3 Pyr_redox Thi4
Motif
Other DBs
NCBI-GeneID: 17267695
NCBI-ProteinID: XP_005774577
JGI: Emihu1_463658
UniProt: R1CH70
Position
Unknown
AA seq 658 aa AA seqDB search
MLPLLAIGFFAPQRPLPTAAAARQRAAASLVRASADMAVDRRVDCIVVGAGISGSTLAHN
LHRGGADVLLAEARDYVGGNVVSHEEDGFVWEDGPNSFATQPSIVRISHELGIEKELVFA
DESLPPWVNHGGKLHPLPKGKGGKGPKGQLELVFGSNGVLKFGLSGSLLSWPGKIRAAIG
ALVGHAPPPEGKEETIREWVTRTLGEEVFLRCIDPFVSGVYAGDPMTLSMSAALSKIARI
ERYSYGIEWNKLGAIFYGGLARQVELTKERKASPPDPAKAGDPGLSTLPHAIAAELGQPH
GAPPDPASRAVRARTVVSTLPAHALRGVIDEVLPGAAPLTEALREGIGRKGIYYPPVAAV
TVAYPKSAFRDVELDNGFGPLRDLPGFGSLNPRSEGVRTLGTLWSSSLFPGRCPPEYNLL
LNYIGGSRDAPIAELSEEAPHTPLHPQYPDPLPPPPAEELVAEVDRGCREVLLKPDVLLK
PDAPPPKVLSAKLWPTAIPQYELGHAPLIEALERAEADTPGLWVCGNYRTGVAFPDCVTF
GYEHAQTVLQYLDAERDAPATPPAAPAATPPPAPPSTPPAPPPPAPPAPPRVRVESWFDT
GVRLARPAEAAEAAGVAEAAGAVGAAGDAHDGAHEWPMLGGSAGPHRMAGRRALAARR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgctcctggcgatcggattcttcgcgccgcagcggccgctgccgaccgcggct
gccgcgcggcagcgggcggcggcctctctcgtgcgcgcctccgccgacatggccgtcgac
cggcgcgttgactgcatcgtcgtcggcgccggcatctcgggctcgacgctggcgcacaac
ctgcaccgcggcggcgcggacgtgctgctcgccgaggcgcgcgactacgtgggtggcaac
gtcgtctcgcacgaggaggacggcttcgtctgggaggatggcccaaactcctttgcgacg
cagccgtcgatcgtccgcatctcgcacgagctcggcatcgagaaggagctggtgtttgcg
gacgagtcgctgccgccgtgggtgaaccacggcggcaagctgcacccgctccccaagggc
aagggcggcaagggcccaaagggccagctcgagctcgtctttggctccaacggcgtcctc
aagtttgggctctctggcagcctgctgtcgtggcccggtaagatccgcgcggcgatcggg
gcgctggttgggcacgcgccgccgcccgaggggaaggaggagaccatccgcgagtgggtg
acgcgcaccctcggcgaggaggtcttcctccgctgcatcgacccctttgtgtcgggcgtg
tacgcgggcgacccgatgacgctctcgatgtccgccgcgctgtccaagatcgcgcgcatc
gagcgctattcgtacgggatcgagtggaacaagctcggcgccatcttctacggcggcctc
gcgcgccaggtcgagctgacgaaggagcgcaaggcgagcccgcccgaccccgccaaggcg
ggggaccccggcctctctacgctgccgcacgcgatagcggccgagctcggccagccgcac
ggcgcgccgcccgacccggcctcgcgcgccgtccgcgcgaggacggtcgtctcgacactc
ccggcgcacgcgctgcgcggcgtgatcgacgaggtccttcccggtgcggcgccgctgaca
gaggcgctgcgcgagggcatcgggcgcaaggggatctactacccgcccgtcgccgccgtc
acggtcgcctacccgaagagcgccttccgcgacgtcgagctcgacaacggcttcgggccg
ctgcgagacctgcccgggtttgggtcgctcaacccgcgctctgagggcgtgcgcacgctg
ggcacgctctggtcgtcctccctcttccccggccgctgcccgcccgagtacaacttgctg
ctaaactacatcggcggctcgcgcgacgcgccgatcgcggagctcagcgaggaggcccca
cacaccccgctccaccctcaataccccgaccctctccctccccctccagcagaggagctg
gttgccgaggttgaccgcggctgccgcgaggtgctgctcaagccggacgtgctgctcaag
ccggacgcgccgccgccaaaggtgctcagcgcaaagctgtggccgacggccatcccgcag
tacgagctcggccacgcgcctctcatcgaggcgctcgagcgcgcagaggccgacacgccc
ggcctgtgggtctgcggaaactaccgcaccggcgtcgccttccccgattgcgtcaccttt
ggctacgagcacgcgcagaccgtgctgcagtacctcgacgccgaacgcgacgcgccggcc
accccgccggccgcgccggcggccaccccgccgcccgcgccgccgtccacgccgcccgcg
ccgccgccgcccgcgccgcccgcgccgccccgcgtcagggtggagagctggttcgacacg
ggcgtgcggctcgcgcggccggccgaggcggcggaggcggcgggggtggccgaggcggcg
ggggcggtgggggcggctggggacgctcatgacggcgctcacgagtggccgatgctcggc
gggagcgcgggcccgcatcgcatggctggccgcagggccttggcagcacgccggtag

DBGET integrated database retrieval system