KEGG   Emiliania huxleyi: EMIHUDRAFT_467817Help
Entry
EMIHUDRAFT_467817 CDS       T02915                                 

Definition
hypothetical protein
Organism
ehx  Emiliania huxleyi
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 813 aa AA seqDB search
MGNGENMPHPPLAAALDKLPFTNAGTVSSSDVFTMRPVPSIYLEPEAPRRARWAWAEGPI
TPFKQFSYLYAEANATPPTGMRSAPPLGGLGSGTVELRADGSLRSWTIENASPAGSAKTG
LLDEAAFGYRLGGAPARLLRTHPPAGLPGVEGIRFSGATPFTRLAPTDSALPAGANLRLY
GRSRWRLGDRSASAVPAAGFTLVATNPTGRPLALSLLFVLPVQASCAAWSFVNATRRCTR
FANFSAVPPAANSASPADGAGVSLCGAGEGGAAAAEVSFGTAGSLVALWRSFAEAGRLDG
AMGGSHGGAVVRLVVAPHGTASATVSLGWYFPARDFMGGLVGNFYASSRLVLGSEEAART
LLPGSEAAADVRGWASFAATLSSPSSSLPAWLGDSLLNSLHHTRSVMWLADGRHIPYLML
WPDALPSKMRAWAAGAMPDGMIQEQLALDAPCGRVMGDVSSMFVVYLLEWWRWTADEPSA
ASLVVEMWPAARAAARYDGLRLSRYNVSCFSALFHLLAMAAARELALSPPVRDAAFAAEC
DAALARGRAAMDALLWVEGGGYYRSYTGGEALMSDSLYAQVLADTLGLGALTSDAQVTRH
LAAVLQRNDSPYGLLCQTGRYPLPAGAGADNSIWMMANPNWASLSLRRGGDPHKALSVVN
KTFGWVRDALADQWNVVAVYGGLGYGAEGLPAANSHYGYHLVAWHLLFALTGQVYSARSR
SLTFAPALRGRFELPVLVPAVAATLSRGSDGECTLAVAAAGSASLVLHTLSVDGVAPPAG
VLPVKLAPGQRVSWGGGAGARTKVTLSSLKPVD
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacggcgagaacatgccccatccacccctcgccgccgccctcgacaaactgccg
ttcacaaacgccggcaccgtctcctcgtctgacgtcttcacaatgcgtcctgtcccgtcc
atctacctcgagcccgaggcgccgaggcgggcgcggtgggcgtgggcagagggtcccatt
acgccgttcaagcagttctcgtacctgtacgctgaagccaacgcgacgccgcctacaggc
atgcgctcggcgccgcctctcggcggcctgggctctggcacggtcgagcttcgcgccgac
ggctcgttgcgctcgtggacgatcgagaatgcctctccggccgggagcgcaaagaccggg
ctgctcgacgaggcggcgttcggctaccggctcggaggcgctccagcgcggctgctgcgc
acgcaccctcctgcggggctcccgggcgtggaggggatccggttcagcggcgcgacgccg
ttcactcggctcgccccgactgactctgctctgcccgccggcgccaaccttcgcctctac
ggccgctcgcgctggcggctgggagaccggtccgcgtccgccgtgcccgcggccggcttc
accctcgtcgcgaccaacccgaccggccggccgctagcgctctccctcctctttgtcttg
ccagtccaggcgtcctgcgcggcgtggtcctttgtcaacgcgacgcgccgctgcacgcgc
ttcgcaaacttctccgccgtcccgccggcggccaactctgcgtcgccggccgacggcgca
ggggtttcgctctgcggcgcgggcgagggcggcgctgcggcggcggaagtctcctttgga
accgccggttcgctcgtcgccctgtggcgatcctttgcggaggcggggcgcctcgacggc
gcgatgggaggctcgcacggcggtgcggtagtgcggctagttgtcgcgccgcacggtacg
gcgagtgcaacggtgagcctcggctggtactttccggcgcgcgactttatgggcgggctg
gttggcaacttctacgcctcctcgaggctcgtgctcggctccgaggaggcggcgcgcacg
ctgctgccgggcagcgaggcggcggcagacgtgcgcggctgggcttccttcgcggcgacc
ctctcctcgccgtcgagcagcctgccggcctggcttggcgactcgctgctcaactccctc
caccacacgcgctcggtgatgtggctcgccgacgggcggcacatcccgtacctcatgctc
tggcccgacgcgcttccgtccaagatgcgcgcctgggccgccggcgccatgccggatggg
atgatccaggagcagcttgcgctcgacgcgccgtgcggccgcgtgatgggcgacgtgagc
tcgatgtttgtcgtctacctgctcgagtggtggcggtggacagccgatgagccgagcgcc
gcatccctcgtcgtcgagatgtggccggccgcgcgggcggcggcgaggtacgacgggctt
cgcctctcgcgctacaacgtctcctgcttctccgccctattccacctcctcgcgatggcc
gccgcgcgtgagctcgccctctcgccccccgtgcgggacgccgcctttgccgccgagtgc
gacgccgccctcgcgcgcggccgcgccgcgatggacgcgctgctctgggtcgagggggga
ggctactaccgcagctacaccggcggcgaggcgctcatgtccgactcgctctacgcgcag
gtcctcgccgatacgctcgggctcggcgcactcacttccgacgcgcaggtgactcgccac
ctcgccgccgtcctccagcggaacgactcgccctacggcctcctctgccagaccggccgc
tacccgctgcctgccggggcgggcgcggacaactcgatctggatgatggccaaccccaac
tgggcgtcgctgagcctgcggcgcggcggcgacccgcacaaggccctctccgttgtcaac
aagacgttcggttgggtgcgtgacgcgcttgccgaccagtggaacgtcgtcgccgtgtac
ggcgggcttggctacggcgccgagggcctccccgccgccaactcgcactacgggtaccat
ctcgtcgcgtggcacttgctcttcgccctcaccggccaggtgtactctgcccgctcgcgc
tcgctcacgttcgcgcccgcgctgaggggccggttcgagctgcccgtgctggttcctgct
gtggcggcgaccctctcgcgcggcagcgacggtgagtgcacgctcgcggtggcggcggca
ggctcggcgagcctcgtgctgcacacgctctccgtcgacggcgtagcgccaccggcgggt
gtcttgccggtcaagctggctcctgggcagagggtgtcgtggggcggcggcgctggtgcg
cgcacgaaagtcactctttcgtctttgaaacctgtcgattaa

DBGET integrated database retrieval system