KEGG   Emiliania huxleyi: EMIHUDRAFT_469732Help
Entry
EMIHUDRAFT_469732 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EMIHUDRAFT_469732
Transcription factors [BR:ehx03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    EMIHUDRAFT_469732
Mitochondrial biogenesis [BR:ehx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    EMIHUDRAFT_469732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1179 aa AA seqDB search
MGRKSVFSKRSRFGGSDLITRIPRSDRSSSQTRHFTFFLSRYTGGGSRLDGPLAGAAQPA
REPLQLELRSVAGRDALRQALLAMVPQIDELQKKRELMKRSGPPPQRPTPMGMPQQGQLP
PGTVQPLAQPTTVQGHVLPNQPGPPPLPQPPPPIPKPVIGPVPPQRSHSQVGLAESAVSG
SAMLEPKMGLPPVAHPPEYKPNLGQHGGQHGMGGVNQNRKSTLPVQALVHAFHCNEAGCK
QKSCVETKQVPSGGHPGATGAAAPRRMSVPSPPDGRVSGGAPRLGGVHSNNEAVRQKLRQ
LDPAQVKRMLLQHVRSCQNKQCHTCHKLRERIKASRANNTGGGGSSHDPLQRPFGGGGIP
PLQRPGSIGGMTAGGMEGSSNILMGGGFGGGGGFGGFPGLDGGPGLLGAGTGVGFGLQGS
SPWVPSAQSGLQRKTKVKQRGRENIQPGLAWSSRQGDQRTALAEGTRFSRIRLKLKGVAP
TLAPSRSRDRKKKARADDDDGGRGEKADIKRLRRQISQKSTQDEEEEMAQAGMDQYRVAP
GRPASLELNKFEVGSWVEHREDASTWRLAIVRSQQQAGGQLQYTIQLEPVEQNRHKQTGV
PHADLRMACSHPECKKHALHLAALPLFCDRCRKALMSTPQQRVYFQEKEAVESGQSLRLC
STCVGSLRAELKSKGQAGLDAEVQKFTRDLPQGADRQSLVLETLEETALPQRAENSDAPI
LSTDIDTRWAQCAGCFKWWHWVCAMYVETQYKNGRPFYCRGCAPKHERLSDELQSLLENN
DATKLTQIPMGEFIEEQVRSDLEEAKIDCTPITIRIVSSLLMNSYTPERLVEHQQALGES
YPREFPYKSKALLAFQKRDGLDVCLFALYVQEYGSDCPEPNKNRVYISYLDSVRYFESEP
MGHRSTVYHSILVAYLQWTRMLGFKYVHIWVEPPKSGDEYIFFARSDQQRKPMKREKLRE
WYKGMLDKAKAKNVVEHYGTMHDMFNGLKSLAEIPLFHGDQWEITVPSLLGLDDEEYVSA
PKSNKLVRMDSKDVVQKAQQEMQHLKRHFLVAVLRDPDLSPMKDNDPVISTDLTDSRQTF
LGQCQMCHWQFNTLRHAQYSTRMILNHIHNKPSYCVEDCQRGRVEDGSFMVGCDVCDNWY
HGDCVGISKDEANTMDSYLCARCRALDESGGLDEGGGGS
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaaaatcggtcttctccaagcgctcgcgcttcggcggtagtgatctgatcacc
cgaataccacgttcggatcgctcctcatcgcaaacccggcacttcaccttctttttgtcg
cgctacacgggcggcggctcgcgcttggacggtcccctcgcaggggcagcgcagcctgcg
agggagccgctgcaactcgagctgcggagcgtggcggggcgcgacgcgctgcggcaggcg
ctgctcgcgatggtgccgcagattgacgagctgcagaagaagcgggagctgatgaagcgc
agtggccccccgccccagcggccgacgccgatgggcatgccgcagcaggggcagctaccg
cccgggacggtgcagccgctggcgcagccgacgacggtgcaggggcacgtgcttccgaac
cagcccgggccgccgccgttgccgcagccgccgccgccgataccgaagccggtgattggg
ccggtgccgccgcagcgctcccactcgcaggtgggcctcgccgagtctgcggtgagcggc
tcggcgatgctggagccaaagatggggctgccgcccgtcgcgcatccgccagagtacaag
ccgaacctggggcagcacggcgggcagcacggcatgggcggcgtcaaccagaaccgcaag
tcgacgctgccagtgcaggcgctcgtgcacgccttccactgcaatgaggcggggtgcaag
cagaagtcgtgcgtagagaccaagcaggtgccgtcgggcggccacccgggcgccaccgga
gctgcggccccccgccgaatgtccgtgccgtcgccgcccgacggcagggtctccggcggc
gcgccgcgtctcgggggcgtgcactccaacaacgaggcggtgcggcagaagctgcggcag
ctcgacccggcgcaggtgaagcggatgctgctgcagcacgtccgctcgtgccaaaacaag
cagtgccacacttgccacaagctacgcgagcggatcaaggcgagccgcgccaacaacacg
ggcggaggcggcagcagccacgacccgctgcagcggccgtttggaggcggcggcatccca
ccgctgcagcgccccggctcgatcggcggcatgaccgccggggggatggaggggtcgagc
aacatcctcatgggtggcggcttcggcggcggtggcggcttcggcgggtttcccggcctg
gacgggggcccgggcctgctcggcgcgggcacgggcgtcggctttgggctgcagggctcg
agcccgtgggtgccgagcgcgcagagcgggctgcagcgcaagaccaaggtgaagcagcgc
ggccgcgagaacatccagcccggcctcgcgtggtcctcgcggcagggcgaccagcggacg
gcgctcgccgagggcacgcggttctcgcgaatcaggctcaagctcaaaggcgttgcgccc
acgctcgccccgtcgcggtcgcgcgaccgaaagaaaaaggcgcgcgccgacgacgatgac
ggcggccgcggcgagaaggcggacatcaagcggctccggcggcagatctcgcaaaagtcg
acgcaggacgaggaggaggagatggcgcaggccgggatggaccagtaccgcgtggcgccc
ggccggcccgcctccctcgagctcaacaagttcgaggtcggctcgtgggtcgagcaccga
gaggacgcgagcacgtggaggctcgcgatagtgcgctcgcagcagcaagcgggcgggcag
ctgcagtacaccatccagctggagccggtggagcagaaccggcacaagcagacgggcgtg
ccgcatgccgatttgcgcatggcgtgctcgcacccagagtgcaagaagcacgccctgcac
ctcgccgcgctgccgctgttttgcgaccgctgtcgcaaggcgctcatgtcgacgccgcag
cagcgcgtctacttccaggagaaggaggcggtcgagtcggggcagtcgctccgcctctgc
agcacttgcgtcggctcgctgcgcgcggagctcaagtccaagggccaggccggcctcgac
gccgaggtgcaaaagttcacgcgcgaccttccgcagggcgccgaccggcagtcgctcgtg
ctcgagactctcgaggagacggcgctgccgcagcgcgccgagaacagcgacgcgcccatc
ctgtcgaccgacatcgacacgcggtgggcgcagtgcgctgggtgcttcaagtggtggcat
tgggtgtgcgccatgtacgtcgagacgcagtacaagaacgggcggcctttctactgccgc
gggtgcgcgcccaagcacgagcggctgtcggacgagctgcagtcgctgctcgagaacaac
gacgcgacgaagctgacgcagatcccgatgggcgagttcatcgaggagcaggtgcgtagc
gacctcgaggaggcgaagatcgactgcacgccgatcaccatccggatcgtctcgtcgctg
ctcatgaactcgtacacgcccgagcggctggtcgagcaccagcaggcgctgggcgagagc
tacccgcgcgagtttccgtacaagtccaaggcgctgctcgcgttccagaagcgggacggg
ctcgacgtctgcctgttcgcgctgtacgtgcaggagtacggctccgactgcccggagccg
aacaagaaccgcgtctacatctcgtacctcgactcggtccgctactttgagtcggagccg
atgggccaccgctcgacggtctaccactcgatcctggtcgcctatctgcagtggacgcgt
atgctcggcttcaagtacgtccacatctgggttgagccgccgaagagcggcgacgagtac
atcttctttgcgcgctcggaccagcagcgcaagccgatgaagcgcgagaagctgcgcgag
tggtacaaggggatgctcgacaaggcaaaggccaagaatgtggtcgagcactacgggacg
atgcacgacatgttcaacggcctcaagtcgctcgccgagatcccgctcttccacggcgac
cagtgggagatcacggtgccgtcgctgctcggcctcgacgacgaggagtacgtctcggcg
ccgaagagcaacaagctcgtgcggatggactccaaggacgtcgtgcaaaaggcgcagcag
gagatgcagcacctgaagcgccacttcctcgtcgcggtgcttcgcgaccccgacttgtcg
ccgatgaaggacaacgacccggtcatctccaccgacctgaccgactcgcgccagaccttc
ctcggccagtgccagatgtgccactggcagttcaacacgctgcggcacgcgcagtactcg
acgcggatgatcctcaaccacatccacaacaagccctcgtactgcgtcgaggactgccag
cgcggccgcgtcgaggacggctccttcatggtcgggtgcgacgtgtgcgacaactggtac
cacggggactgcgtcggcatctcgaaggacgaggcaaacacgatggactcgtacctttgc
gcgcgctgccgggcgctcgacgagtcgggtgggctcgacgagggcggcggcggcagctga

DBGET integrated database retrieval system