KEGG   Emiliania huxleyi: EMIHUDRAFT_521922Help
Entry
EMIHUDRAFT_521922 CDS       T02915                                 

Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ehx  Emiliania huxleyi
Pathway
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EMIHUDRAFT_521922
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EMIHUDRAFT_521922
Enzymes [BR:ehx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EMIHUDRAFT_521922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 804 aa AA seqDB search
MAFDALLASGRAAAEIRDAISEQEIEIVLTAHPTEAQRRTILKKHQQIVALLGQHDKGTV
LTPGEVTELEEAISREQAAAWRTSNVRRSKPTAEGEARNGLMVIEETCWDAVPEHYRRLD
RALRRIGQPPAIVKVSTWMGGDRDGNPNVTAVTTGHVLCLQRARAAELYHKEVEKLLYEL
SHTGPVSAEMRAAQRNARRAAAAAGQRHRDAHRGGLPPAGRGREPEADERARRQHGREHV
ALVRPVARRADEPGEPRARPADPGHRVRATSFDSRALCTGDRVLANGTLLDLLRRVRTFG
ICLAKMDIRQAESDRHSEAIDAITRALGLGRYLEWDEEARIAWLSAELEGGAPPPDPRIL
PLAGTLAADERVKEVLATFALLATLPPECLGAYCISMARSASDVLAVRLLQVKSGVKSPM
RVAPLFETREDLQNAPRVVARLFSVAAYKGAIGGFHEVMLGYSDSSKDAGKFASLWELHV
AMEKILEAGRAAGVRINFFHGRGGSIGRGGGPLHLALLSQPAGSIAGAYRVTVQGEQIQA
FLASTELAVHTFQSYAISVLEHTISPPKLPTDAQRELMQQLADASAKAFQAQVYQSEDGI
FSRYFHAATPTSALASMNLGSRPAKRKAAGGIETLRAIPWVFAWTQTRLHLPVWLGCGAA
LAERIAGGGLAELRDAYSTWPFFRGLVDLMELELSKAEPAVSEYYDGRLCTPDLRAVGDG
LRSALAQAKAAVMEVAGHALLLENHPLAKQSFGLRQPYLLTLHAIQGEVMARLKKEPSDA
ERLALDDAMTVTVQGVAAGMQNTG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgacgcgctcctcgcaagtggccgcgccgccgccgagatccgcgacgcaatc
tccgagcaggagatcgagattgtgctgacggcgcacccgaccgaggcgcagcggcggacg
atcctcaagaagcaccagcagatcgtggcgctgctcggccagcacgataagggaaccgtg
ctcacccccggcgaggtgaccgagctcgaggaggcaatctcgcgcgagcaggcggcggcg
tggcgcacctccaatgtgcgccgctccaagccgacggcggaaggcgaggcgcgcaacgga
ctgatggtgattgaggagacctgctgggacgccgtgccagagcactaccgccgccttgac
cgcgccctccgccggatcggccagccgccggccatcgtcaaagtgtcgacatggatgggc
ggagaccgcgacgggaacccaaacgtcacggccgtcacgacgggccacgtgctgtgcctg
cagcgggcgcgggcagcggagctgtaccacaaggaggtggagaagctgctctatgagctc
tcgcacaccggccccgtctctgcggagatgcgcgccgcccagcgtaatgctcgacgggct
gccgcggctgccggccagcgtcaccgagatgctcaccgaggtgggctccctcccgcagga
cgcggccgagagcctgaggctgatgagcgagcgcgccggcaacatggacgcgagcacgtt
gctctcgtccgcccagttgctcggcgagctgatgagccaggcgaacctcgcgctcgccca
gcagacccgggccaccgggtgcgagcaacgtcttttgacagccgggcgttgtgcacaggc
gaccgcgtcctcgccaacggcacgctcctcgacctgctccgccgcgtgcgcacctttggc
atctgcctcgccaagatggacatccgccaggcagagagcgaccggcactccgaggcgatc
gacgcaatcacgcgcgccctcgggctcggcaggtacctcgagtgggacgaagaggcgcgg
attgcgtggctctcggcggagctggagggaggggcccccccgcccgacccgcggatactc
cctctcgcaggcacgctggcggcagacgagcgggtgaaggaggtgttggcgaccttcgcc
ctcctcgccacgctgccgcccgagtgcctgggcgcctactgcatctcgatggcgcgcagc
gcgtccgacgtgctcgcggtgcggctgctgcaggtcaagagcggcgtcaagtcgccgatg
cgcgtcgcgccgctcttcgagacgcgcgaggacctgcagaatgcgccgcgcgtcgtcgcg
cgcctcttctccgtcgccgcctacaagggcgccatcggaggcttccacgaggtgatgctc
ggctactctgactcgtccaaggacgccggcaagttcgcctcgctctgggagctccacgtc
gccatggagaagattctggaggcgggccgcgccgccggcgtgcgcatcaacttcttccac
gggcgcggcggctccatcggccgcggaggcggccccctccacttggcgctgctgtcgcaa
cccgccggctcgattgccggcgcgtaccgcgtaaccgtgcagggggagcagatccaggcc
ttcctcgcctccaccgagctcgcggtgcacaccttccagagctacgccatctccgtgctc
gagcacacgatctcgccgccaaagctccccaccgacgcgcagcgcgagctgatgcagcag
ctggccgacgcgtctgccaaggcctttcaggcgcaggtctaccagtcggaagacggcatc
ttctcgcgctactttcacgccgccacgccgacgtcggcgctggcctcgatgaacctcggc
tcgcggcccgcgaagcgcaaggctgccggcggtatcgagacgctccgcgcgatcccgtgg
gtgtttgcctggacgcagacgcggctccacttgcccgtgtggcttgggtgcggcgcggcg
ctcgcggagcgtatcgccggaggcgggctcgccgagctgcgtgacgcgtactcgacctgg
cccttcttccgcggcctggtggacctgatggagctcgagctctccaaggcggagcccgcc
gtctccgagtactatgacggccgcctctgcacgccggacctccgcgcggtcggcgatggg
ctgcggtcggcgctcgcgcaggcgaaggcggccgtcatggaggttgcgggccacgccctc
ctcctcgagaaccacccgctcgccaagcagtccttcggcctgcggcagccgtacctgctc
accctgcacgccatccagggcgaggtgatggcgcgcctcaagaaggagccgagcgacgcg
gagaggctcgcgctggacgacgccatgaccgtcaccgtgcagggggtcgccgccggcatg
caaaacaccggctag

DBGET integrated database retrieval system