KEGG   Emiliania huxleyi: EMIHUDRAFT_521922Help
Entry
EMIHUDRAFT_521922 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00620  Pyruvate metabolism
ehx01100  Metabolic pathways
ehx01200  Carbon metabolism
Module
ehx_M00168  CAM (Crassulacean acid metabolism), dark
ehx_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EMIHUDRAFT_521922
Enzymes [BR:ehx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EMIHUDRAFT_521922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 17260279
NCBI-ProteinID: XP_005766599
JGI: Emihu1_521922
UniProt: R1DI14
Position
Unknown
AA seq 804 aa AA seqDB search
MAFDALLASGRAAAEIRDAISEQEIEIVLTAHPTEAQRRTILKKHQQIVALLGQHDKGTV
LTPGEVTELEEAISREQAAAWRTSNVRRSKPTAEGEARNGLMVIEETCWDAVPEHYRRLD
RALRRIGQPPAIVKVSTWMGGDRDGNPNVTAVTTGHVLCLQRARAAELYHKEVEKLLYEL
SHTGPVSAEMRAAQRNARRAAAAAGQRHRDAHRGGLPPAGRGREPEADERARRQHGREHV
ALVRPVARRADEPGEPRARPADPGHRVRATSFDSRALCTGDRVLANGTLLDLLRRVRTFG
ICLAKMDIRQAESDRHSEAIDAITRALGLGRYLEWDEEARIAWLSAELEGGAPPPDPRIL
PLAGTLAADERVKEVLATFALLATLPPECLGAYCISMARSASDVLAVRLLQVKSGVKSPM
RVAPLFETREDLQNAPRVVARLFSVAAYKGAIGGFHEVMLGYSDSSKDAGKFASLWELHV
AMEKILEAGRAAGVRINFFHGRGGSIGRGGGPLHLALLSQPAGSIAGAYRVTVQGEQIQA
FLASTELAVHTFQSYAISVLEHTISPPKLPTDAQRELMQQLADASAKAFQAQVYQSEDGI
FSRYFHAATPTSALASMNLGSRPAKRKAAGGIETLRAIPWVFAWTQTRLHLPVWLGCGAA
LAERIAGGGLAELRDAYSTWPFFRGLVDLMELELSKAEPAVSEYYDGRLCTPDLRAVGDG
LRSALAQAKAAVMEVAGHALLLENHPLAKQSFGLRQPYLLTLHAIQGEVMARLKKEPSDA
ERLALDDAMTVTVQGVAAGMQNTG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgacgcgctcctcgcaagtggccgcgccgccgccgagatccgcgacgcaatc
tccgagcaggagatcgagattgtgctgacggcgcacccgaccgaggcgcagcggcggacg
atcctcaagaagcaccagcagatcgtggcgctgctcggccagcacgataagggaaccgtg
ctcacccccggcgaggtgaccgagctcgaggaggcaatctcgcgcgagcaggcggcggcg
tggcgcacctccaatgtgcgccgctccaagccgacggcggaaggcgaggcgcgcaacgga
ctgatggtgattgaggagacctgctgggacgccgtgccagagcactaccgccgccttgac
cgcgccctccgccggatcggccagccgccggccatcgtcaaagtgtcgacatggatgggc
ggagaccgcgacgggaacccaaacgtcacggccgtcacgacgggccacgtgctgtgcctg
cagcgggcgcgggcagcggagctgtaccacaaggaggtggagaagctgctctatgagctc
tcgcacaccggccccgtctctgcggagatgcgcgccgcccagcgtaatgctcgacgggct
gccgcggctgccggccagcgtcaccgagatgctcaccgaggtgggctccctcccgcagga
cgcggccgagagcctgaggctgatgagcgagcgcgccggcaacatggacgcgagcacgtt
gctctcgtccgcccagttgctcggcgagctgatgagccaggcgaacctcgcgctcgccca
gcagacccgggccaccgggtgcgagcaacgtcttttgacagccgggcgttgtgcacaggc
gaccgcgtcctcgccaacggcacgctcctcgacctgctccgccgcgtgcgcacctttggc
atctgcctcgccaagatggacatccgccaggcagagagcgaccggcactccgaggcgatc
gacgcaatcacgcgcgccctcgggctcggcaggtacctcgagtgggacgaagaggcgcgg
attgcgtggctctcggcggagctggagggaggggcccccccgcccgacccgcggatactc
cctctcgcaggcacgctggcggcagacgagcgggtgaaggaggtgttggcgaccttcgcc
ctcctcgccacgctgccgcccgagtgcctgggcgcctactgcatctcgatggcgcgcagc
gcgtccgacgtgctcgcggtgcggctgctgcaggtcaagagcggcgtcaagtcgccgatg
cgcgtcgcgccgctcttcgagacgcgcgaggacctgcagaatgcgccgcgcgtcgtcgcg
cgcctcttctccgtcgccgcctacaagggcgccatcggaggcttccacgaggtgatgctc
ggctactctgactcgtccaaggacgccggcaagttcgcctcgctctgggagctccacgtc
gccatggagaagattctggaggcgggccgcgccgccggcgtgcgcatcaacttcttccac
gggcgcggcggctccatcggccgcggaggcggccccctccacttggcgctgctgtcgcaa
cccgccggctcgattgccggcgcgtaccgcgtaaccgtgcagggggagcagatccaggcc
ttcctcgcctccaccgagctcgcggtgcacaccttccagagctacgccatctccgtgctc
gagcacacgatctcgccgccaaagctccccaccgacgcgcagcgcgagctgatgcagcag
ctggccgacgcgtctgccaaggcctttcaggcgcaggtctaccagtcggaagacggcatc
ttctcgcgctactttcacgccgccacgccgacgtcggcgctggcctcgatgaacctcggc
tcgcggcccgcgaagcgcaaggctgccggcggtatcgagacgctccgcgcgatcccgtgg
gtgtttgcctggacgcagacgcggctccacttgcccgtgtggcttgggtgcggcgcggcg
ctcgcggagcgtatcgccggaggcgggctcgccgagctgcgtgacgcgtactcgacctgg
cccttcttccgcggcctggtggacctgatggagctcgagctctccaaggcggagcccgcc
gtctccgagtactatgacggccgcctctgcacgccggacctccgcgcggtcggcgatggg
ctgcggtcggcgctcgcgcaggcgaaggcggccgtcatggaggttgcgggccacgccctc
ctcctcgagaaccacccgctcgccaagcagtccttcggcctgcggcagccgtacctgctc
accctgcacgccatccagggcgaggtgatggcgcgcctcaagaaggagccgagcgacgcg
gagaggctcgcgctggacgacgccatgaccgtcaccgtgcagggggtcgccgccggcatg
caaaacaccggctag

DBGET integrated database retrieval system