KEGG   Emiliania huxleyi: EMIHUDRAFT_55855Help
Entry
EMIHUDRAFT_55855  CDS       T02915                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ehx  Emiliania huxleyi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ehx01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ehx01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 223 aa AA seqDB search
GITAGYHRYFAHGSYRTSRPFQFALAVLGASAWQKGPLWWASHHAEHHLHSDSAGDPHSP
VCGSLLWAHMGWFWACMEYDAHPAAFQAGRGRVARFRQYPELVALDRFHHGPGIALGALA
YAADGLPGLLWGFIVPTVGVWHATFAVNSACHRWGSRRFATTDNSRNNVWVALAAFGEGN
HNNHHAFPWSARHGLTWREPDLSYAILRALELLGVVWDLRLPT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ggcatcacggcgggctaccatcggtactttgcccacgggtcctaccgcacctcgcggccg
ttccagttcgcgctggcggtgctcggcgcgagcgcgtggcagaagggtccgctttggtgg
gcatcgcaccacgccgagcaccacctgcactctgactcggcgggcgacccgcacagcccc
gtctgcggctcgctgctctgggcgcacatgggctggttctgggcgtgcatggagtacgac
gcccaccccgcagccttccaggcgggccgcggccgcgtcgcgcgcttccgccagtacccc
gagctggtcgccctggaccgcttccaccacgggcctggcatcgcgctgggcgcactcgcc
tacgcggcggacggcttgccgggcctgctctggggcttcatcgtgccgacggtgggcgtg
tggcacgccacttttgccgtcaacagcgcctgccaccgctggggctcgcgccgcttcgcc
acgaccgacaacagccgcaacaacgtgtgggtcgccctcgccgcctttggggaggggaac
cacaataaccaccacgccttcccgtggtcggcgcggcacgggctgacctggcgcgagccg
gacctctcatacgcaatcctgcgcgcgctcgagctgctcggggtcgtgtgggacctgagg
ctgcccacg

DBGET integrated database retrieval system