KEGG   Emiliania huxleyi: EMIHUDRAFT_61724Help
Entry
EMIHUDRAFT_61724  CDS       T02915                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ehx  Emiliania huxleyi
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EMIHUDRAFT_61724
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EMIHUDRAFT_61724
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EMIHUDRAFT_61724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 453 aa AA seqDB search
MPFGTAYGYALLLAASSSATAAAAATAGAVPLTITETSPISADGVPRLLARLPGVELLPM
RPKKNSKPAPPTTDQITVIINSTTTYQTILGFGGAFTEAAAHNWIRLSPRDRAEVMRLYF
AKPSEGGHGYTLGRVPINSCDFSVRPYTFDEVAGDRELEHFDTTVSHDVANGIVPMIQAA
QREVAQRGGGALTMFASPWSPPAWMKIPLLPPTGARGPAPSGISIARCLGPWAKYFSLWI
DAYQRHGIRIWAVTIQNEPMAAVGWESCLWSANNSAAFVRDHLGPVLAREQPGVLIIGYD
HNKDKVAKWAKALYEDPLAAQYVAGVAVHWYGGLKTESLDETHALAPGKFILASEACNCG
GVVFEQPDARRWWARAEDLALDILVDLLHWAVGWTDWNLILDITGGPNHAHNLCDANIIA
DPPNARGHGTLTLQASFYFQGHFSRFIPPGSIR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgggacggcatatgggtatgcgctcctcctggccgcctcgtcgtcggcaacc
gctgccgccgccgccactgccggcgcagtcccgctcaccatcaccgaaacctctccaatc
tctgcagacggtgtgccacggctgctggcgcgccttccgggcgtggagctgctgcccatg
cgcccaaagaagaactcgaaaccagcacctcccacgacggaccagatcacagtgatcatc
aactccacgaccacatatcagacaatcctcggctttggcggggccttcacagaggctgca
gcgcacaactggattcgcctcagtccccgcgaccgtgccgaggtgatgcgactttacttt
gccaagccttccgagggtgggcatgggtacacgctcggtcgggtccccatcaatagctgc
gacttctcagtccgcccctacaccttcgacgaggtcgcaggcgaccgtgaattggagcat
tttgacaccaccgtgtctcacgacgtagccaatggcattgtgcccatgattcaggccgca
cagcgtgaggttgcgcagcgcggcggaggagctctgactatgtttgcctctccgtggtcg
cctccggcgtggatgaaaattccactcctccctcccacgggcgctcgggggccggcgccc
tctgggatctcgattgcgcgctgtctgggcccctgggcaaagtacttttcgctctggatc
gatgcgtaccagcggcacggcatccgaatctgggccgtgacgattcagaacgagcccatg
gctgccgtcggttgggagtcgtgcctttggagtgccaacaattcggcagcgtttgtgcgg
gaccatctcgggccggtgctcgctcgagagcagcccggagtgttgatcataggctacgat
cacaacaaggacaaggtcgcgaagtgggcaaaggcgctatacgaggacccgctagcagcg
cagtatgtggcaggcgtggcggtgcactggtatggcggcctcaagacagagagcctcgac
gagacgcacgccctcgcgcccggcaaatttatccttgcgtctgaggcctgcaactgcggc
ggcgtggtctttgagcaaccggacgctcggcggtggtgggcgagggccgaggatctcgcc
ctcgatattcttgtggacctgctccactgggccgttggatggacggactggaacctgata
ctcgacatcaccggcggcccaaatcacgctcacaacctctgcgacgcgaatatcattgcc
gacccgcccaatgcgcgcggccatggaactctgacgctgcaggccagcttctactttcag
gggcacttctctcggttcattccacccggctcgatccgc

DBGET integrated database retrieval system