KEGG   Emiliania huxleyi: EMIHUDRAFT_632222Help
Entry
EMIHUDRAFT_632222 CDS       T02915                                 

Gene name
PI3K1
Definition
phosphatidylinositol-3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ehx  Emiliania huxleyi
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EMIHUDRAFT_632222 (PI3K1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    EMIHUDRAFT_632222 (PI3K1)
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     EMIHUDRAFT_632222 (PI3K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 885 aa AA seqDB search
MRALRPTEAAAHSAAAVWRHLPTFRCESQNASWLPEQFTATVRLSDEMTKKLPVDAATTV
DALRAKALAAYAKATLDDSRPAHLMCLKVVGCDEYLDGGIVVSYEYVRRCLRKGAEVALS
LVPNPLASLPPLSSVPPQPPQPALASGPPSCSLSLYDLPDHLKLRVEIISAERLRSVLAA
AYSSPRRGGACSGVWALSVRLGVYHGGVPLCDPVETPAAICDEGSNPSWSASLQTSLPLH
HIPRAARVCFTLCARPAGGRAARDDEGAATSCSLGWVSMMLVGHDERLANGTHALRLWPE
ESANPIGCNLENATFDPSQPEPPVLFVAFDRFAVPVVMPPDEEFDSASAPEPPPPMPPRA
RRPGSLAAGALPSTQEVLRLKRIIEQDPLSPLSLDEKELVWRHREFVSSSPEALSKLLES
CKWDDRTAVAEAHALLRKWAVPSPTQALKLLDAKFADPQVRAYAVERLGEMSDTALAELV
LQLTQVLKYESRHDSALARLLLRRALRCPHQVGHRFFWALKAEMHLPEVSERFGLLLQEY
LRCCGPHREKLLLQSRVEQSLIAIARAVQREKKSERIALLRQKLSETELPPRFQLPLDPR
IECTGLVVSKCRCMDSKKVPLWLVFSNADPQGTDVTVMFKCGDDLRQDALTMQLIRSMER
KWEAEDLDLRLSPYGVVATGDEVGFIEIVLNSNTTANITKEYGGGASGAFAKEPMAHYLR
EHNKSEREYAAAVETFAHSLAGYCVATYVLGIGDRHNDNVMLSKNGHLFHIDFGHFLGNY
KSKFGIKRERAPFVFTPDFARVLGDKGHSDYEHFVALCCRAYGILRGHSHEFITLFQLML
STGIPELQRAEDIFWAAEHFTKLISAALSSRTTQVNNAVHIIAHS
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctgaggccgacggaggccgcagcacactcggccgcggccgtgtggcgccac
ctccccaccttccgctgcgagtctcagaacgcgtcgtggctccccgagcagttcaccgcg
acggtccgcctctcggacgagatgaccaagaagctgcccgtggacgcggcgaccacggtg
gacgcgcttcgcgcgaaggcactcgcggcgtacgccaaggcgaccctcgacgactcgcgc
ccggcccacctcatgtgtctcaaggtcgtcggttgcgacgagtacctcgacggcgggatc
gtggtgagctacgagtacgtgcgccgctgcctcagaaagggggcggaggtggcgctctcg
ctcgtccccaacccgctcgccagcctgccgcccctcagcagtgtgccgccgcagccgccg
cagccagcgcttgcgagcgggccgccgtcctgctctctctctctctacgaccttccagac
cacctcaagctgcgagtcgagatcatctctgcagaacggctccgctcggtcctcgcagcg
gcctacagcagtccccggcgtggtggcgcctgcagcggcgtgtgggctctctccgtgcga
ctcggtgtctatcatggcggcgtgccgttatgcgacccagtggagacgccagcggcgatc
tgcgacgagggcagcaacccgagctggtcggcgagcctgcaaacgagcctgccgctgcac
cacattcctcgcgccgcccgcgtctgcttcacactctgcgcgcggccggctggggggcgg
gcggcccgcgacgacgagggcgccgccaccagctgcagcctcggctgggtctcgatgatg
ctggtggggcacgacgagcgccttgcgaacggcacgcacgctctgcggctctggccagag
gagagcgcaaacccaatcggctgcaatttggagaacgcaacgttcgacccgtcccagcca
gagccgcccgtcctcttcgttgcgttcgaccgcttcgccgtgccagtcgtcatgcccccc
gacgaagagttcgacagcgcctcggccccggagccgccgcccccgatgccgccgcgggct
cgccgcccgggctcgctcgcggcgggagctctgcccagtacgcaggaggtgctgcggctg
aagcgcatcatcgagcaggaccctctctcgcccctctccctcgacgagaaggagctcgtg
tggaggcaccgcgagttcgtctcgtcctcgcccgaggcgctgagcaagctgctcgagtcg
tgcaagtgggacgaccgcacggctgtcgctgaggcgcacgcactactgcggaagtgggcc
gtcccatcgccgacccaggcgctcaagctcctcgacgccaagttcgccgacccgcaagtg
cgcgcatacgccgtcgagcgactcggggagatgagcgacacggccctcgccgagctggtg
ctgcagctcacgcaggtcctcaagtacgagtcgcggcacgactcggccctcgcgcggctg
ctgctgcgacgcgcactgcgctgtccacaccaggtcggccaccggttcttctgggcgctc
aaggccgagatgcacttgccggaggtttcggagcgcttcggcctcctgctacaagagtac
ctgcgctgctgcggccctcaccgcgagaagctcctgcttcagtcgcgcgttgagcagtcg
ctgattgcaatcgcacgggcggtgcagcgcgagaagaagtcggagcggattgcgcttctg
cggcagaagctcagcgagacggagctaccgccgcgcttccagctgccgctagacccccgc
atcgagtgcacgggcctcgttgtgagcaagtgccggtgcatggactcgaagaaggtgcct
ctgtggctggtcttctccaacgcggacccgcagggcacggacgtcaccgtcatgttcaag
tgcggcgacgacttgcggcaggacgcgctgacgatgcagctcatccggagcatggagcga
aagtgggaggccgaggacctcgatctccggctctcgccgtatggagtcgtcgcgactggc
gacgaggtgggcttcatcgagatcgtgctcaattcgaacacgacggcaaatatcacaaag
gagtacggcggcggcgcatccggcgcgtttgcaaaggagccgatggcacactatttgcgc
gagcacaacaagagcgagcgcgagtatgccgcggccgtcgagacctttgcgcactcgctc
gcgggctactgcgtcgccacatacgtgctcggcatcggcgaccggcacaatgacaacgtg
atgctctccaagaatggccacctcttccacatcgactttggccatttcctgggcaactac
aagtccaagtttgggattaagcgcgagcgggccccgttcgtcttcaccccagacttcgct
cgtgtcctcggcgacaagggccacagcgactacgaacacttcgtagccctctgctgccga
gcgtacggcattctacgcggacacagccacgagttcatcacgctcttccagctgatgcta
tcgacgggcatccccgagctgcagcgggccgaagacatcttctgggcggcggaacacttt
acgaagctgatctccgccgcgctcagctcgcgcacaacgcaggtgaacaacgcggttcac
atcattgcacactcttag

DBGET integrated database retrieval system