KEGG   Emiliania huxleyi: EMIHUDRAFT_64183Help
Entry
EMIHUDRAFT_64183  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00511  Other glycan degradation
ehx00600  Sphingolipid metabolism
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EMIHUDRAFT_64183
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EMIHUDRAFT_64183
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EMIHUDRAFT_64183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 17274148
NCBI-ProteinID: XP_005780823
JGI: Emihu1_64183
UniProt: R1F573
Position
Unknown
AA seq 367 aa AA seqDB search
MPPIDLKPLSELGHSERHVLLQRRERHQEILGFGGAFTEAAALNWQSLSPSDQRRVIRLY
FASPEDGGLGYTVGRVPIGSCDFGPGGVNRTYSFAEEAGDTHLHHFDDSMQHDVDNGIIP
MIHAAMAELERWTADSLSLVASPWSPPAWMKLPVGGVQSMIRTAQPNGLDPAKQRPYAHY
FSRFLSGYAARGIDVWGVTIQNEAEAADVGWEKCVYTADYMASFVKEHLGPVLREEHPRV
KIIGFDHNKDHVLTYARGLYADPAAAHYFDGIGMHWYGGLNTDNLDGTHALAPDKFLLAT
EACNCPGVIYEAEAAAEWWQRAEHLGMDILQDLLHWSVGWIDWNLILDTTGGPNHLGNRC
DANLIAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccatcgacctcaagccgctctccgagctgggccacagcgagcggcatgtgctt
ctccagcggcgcgagcgtcaccaggagatcctcggctttggcggtgcctttaccgaggcg
gctgcgctgaactggcagagcctctcgccctccgaccagcggcgtgtcatccggctctac
tttgcatcgcccgaagacggcgggctcggctacaccgtcggccgggtgccgatcgggtct
tgcgactttgggccgggcggcgtgaaccgcacctactcattcgcagaggaggcgggcgac
acgcacctgcatcactttgacgactcgatgcagcacgacgtcgacaacggcatcatcccg
atgatccacgcggcgatggcggagctcgagcgctggacggccgacagcctctccctggtg
gcgtcgccctggtcgccgccagcgtggatgaagctgccggtcggcggcgtgcagtcgatg
attcggacggcgcagccaaacggcctcgacccggcgaagcagcggccgtacgcgcactac
ttctcgcgcttcctctctgggtacgcggcgcgcggcatcgacgtctggggcgtgacgatc
cagaacgaggccgaggcggcggacgtcggctgggagaagtgtgtctacacggccgactac
atggcctccttcgtcaaggagcacctcggccccgtgctgcgcgaggagcacccgcgcgtc
aagatcatcggcttcgaccacaacaaggaccacgttctcacctacgcgcgcggcctctac
gcggacccggcggccgcccactacttcgacgggatcggcatgcactggtacggagggctc
aacacagacaacctcgacgggacgcacgcgctcgcgccggacaagttcctgctcgccacc
gaggcgtgcaactgccccggagtcatctacgaggcggaggcggccgccgagtggtggcag
cgggccgagcacctcgggatggacatcctgcaggacctgctccactggtcggtcggctgg
atcgactggaacctgatcctcgacaccaccggcggcccgaaccacctcggcaaccgatgc
gacgccaacctcatcgccgac

DBGET integrated database retrieval system