KEGG   Emiliania huxleyi: EMIHUDRAFT_64273Help
Entry
EMIHUDRAFT_64273  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00100  Steroid biosynthesis
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    EMIHUDRAFT_64273
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     EMIHUDRAFT_64273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295 TipE
Motif
Other DBs
NCBI-GeneID: 17273215
NCBI-ProteinID: XP_005780099
JGI: Emihu1_64273
UniProt: R1ELY1
Position
Unknown
AA seq 370 aa AA seqDB search
MPDAKAAVLLTAFSGLALLIYAIPGPVKFGPISDRGARPAYADNAMWHCVLFPLVFVLGA
AAGLYPLSVLYDHFGATVGLLNFGGLAFCALLYAKGLSRLGLRPSGPDAGSSGKGLLFDY
YWGTELYPQLGGVDVKRFVNCRISMTYWMLAGVSFAAAHGRLDPGLVLCAASQFVYLVKF
FYWEIGYMRSIDIITDRAGFYETWGCLVWVPSIYTLHTRSMRSGSPLGAIFAVGLLGVAF
NFEADLQRQRFRETGGAALVWGRKPIAIEAEYHLARHTSLLLVSGWWGVARHAQYLFELT
AEICQQAAWSWGLLAGVGTHGALPLFYAAFLTVLLVHRAIRDEEKCSLKYGAAYAKYKAM
VPYKIVPYVF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgcaaaggcggccgtgcttctcacagccttctccggcctggcgctgctgatc
tacgccatccccggcccggtcaagttcggccccatctcggaccgcggcgcccggcccgcc
tacgccgacaacgcgatgtggcactgcgtgctgtttccgctcgtctttgtgctcggcgcg
gcggcgggtctctacccgctctcagtgctttacgaccacttcggcgcgacggtcgggctg
ctcaactttggcgggctcgccttctgcgcgctgctctacgccaagggcctcagccggctc
ggcctccgcccctccggcccggacgcaggctcgtctggcaaggggctgctcttcgactac
tactggggcacggagctctacccgcagctgggcggcgtcgacgtgaagcgcttcgtcaac
tgccgcatctcgatgacctactggatgctcgccggcgtctccttcgccgccgcgcacggc
cggctcgacccgggcctcgtcctgtgcgccgcgtcgcagtttgtctacctcgtcaagttc
ttctactgggagatcggctacatgcgctccatcgacatcatcaccgacagggcgggcttc
tacgagacgtggggctgcctggtctgggtgccctccatctacacgctccatacgcggagc
atgcggtcggggtcgcccttaggcgccatcttcgccgtcgggctgctcggcgtcgcattc
aacttcgaggcggacctgcagcggcagcgcttccgcgagacgggcggcgcggccctcgtg
tggggccgcaagccgatcgccatcgaggccgagtaccacctcgcgcgccacacgagcttg
ctcctcgtctccggctggtggggcgtcgcgcggcacgcgcagtacctcttcgagctcacg
gccgagatctgtcaacaggccgcttggtcgtggggcttgctcgccggcgtcggcacgcac
ggcgcgttgccgctcttctacgcggccttcctcaccgtgctgctcgtgcaccgcgccatc
cgcgacgaggagaagtgctcgctcaagtacggcgcggcgtacgcaaagtacaaggcgatg
gtaccgtacaagattgtgccgtacgtcttttga

DBGET integrated database retrieval system