KEGG   Emiliania huxleyi: EMIHUDRAFT_64273Help
Entry
EMIHUDRAFT_64273  CDS       T02915                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ehx  Emiliania huxleyi
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    EMIHUDRAFT_64273
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     EMIHUDRAFT_64273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 370 aa AA seqDB search
MPDAKAAVLLTAFSGLALLIYAIPGPVKFGPISDRGARPAYADNAMWHCVLFPLVFVLGA
AAGLYPLSVLYDHFGATVGLLNFGGLAFCALLYAKGLSRLGLRPSGPDAGSSGKGLLFDY
YWGTELYPQLGGVDVKRFVNCRISMTYWMLAGVSFAAAHGRLDPGLVLCAASQFVYLVKF
FYWEIGYMRSIDIITDRAGFYETWGCLVWVPSIYTLHTRSMRSGSPLGAIFAVGLLGVAF
NFEADLQRQRFRETGGAALVWGRKPIAIEAEYHLARHTSLLLVSGWWGVARHAQYLFELT
AEICQQAAWSWGLLAGVGTHGALPLFYAAFLTVLLVHRAIRDEEKCSLKYGAAYAKYKAM
VPYKIVPYVF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgcaaaggcggccgtgcttctcacagccttctccggcctggcgctgctgatc
tacgccatccccggcccggtcaagttcggccccatctcggaccgcggcgcccggcccgcc
tacgccgacaacgcgatgtggcactgcgtgctgtttccgctcgtctttgtgctcggcgcg
gcggcgggtctctacccgctctcagtgctttacgaccacttcggcgcgacggtcgggctg
ctcaactttggcgggctcgccttctgcgcgctgctctacgccaagggcctcagccggctc
ggcctccgcccctccggcccggacgcaggctcgtctggcaaggggctgctcttcgactac
tactggggcacggagctctacccgcagctgggcggcgtcgacgtgaagcgcttcgtcaac
tgccgcatctcgatgacctactggatgctcgccggcgtctccttcgccgccgcgcacggc
cggctcgacccgggcctcgtcctgtgcgccgcgtcgcagtttgtctacctcgtcaagttc
ttctactgggagatcggctacatgcgctccatcgacatcatcaccgacagggcgggcttc
tacgagacgtggggctgcctggtctgggtgccctccatctacacgctccatacgcggagc
atgcggtcggggtcgcccttaggcgccatcttcgccgtcgggctgctcggcgtcgcattc
aacttcgaggcggacctgcagcggcagcgcttccgcgagacgggcggcgcggccctcgtg
tggggccgcaagccgatcgccatcgaggccgagtaccacctcgcgcgccacacgagcttg
ctcctcgtctccggctggtggggcgtcgcgcggcacgcgcagtacctcttcgagctcacg
gccgagatctgtcaacaggccgcttggtcgtggggcttgctcgccggcgtcggcacgcac
ggcgcgttgccgctcttctacgcggccttcctcaccgtgctgctcgtgcaccgcgccatc
cgcgacgaggagaagtgctcgctcaagtacggcgcggcgtacgcaaagtacaaggcgatg
gtaccgtacaagattgtgccgtacgtcttttga

DBGET integrated database retrieval system