KEGG   Emiliania huxleyi: EMIHUDRAFT_64305Help
Entry
EMIHUDRAFT_64305  CDS       T02915                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ehx  Emiliania huxleyi
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EMIHUDRAFT_64305
   00330 Arginine and proline metabolism
    EMIHUDRAFT_64305
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EMIHUDRAFT_64305
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EMIHUDRAFT_64305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 532 aa AA seqDB search
MLESTVSSAFLVKLLEGSGLQRGDARLTDFYGKLRDLDALEVDRPLTLAVFDKLVAPCRD
IIYLAISGDLSIPDFSAFGSTLEKIYSKINEIKSGANASYIPQLAQVNPEQFGISVTTVS
GQHLSIGDSDVPFCIQSCSKPLSYLMALGEHGSAYVHRCVGTEPSGQRFNEMVLKDAPEP
KQPSRRIPHNPMINAGAMMMCSMLSPKLTREERLEKVLDTWRALTAGAGPDPVGYDDATY
QSESATADRNWCLAYMMKESGAFPPCFTSLSETLELYFQICSILCTSRGMSVMAATLANG
GLNPITGERVFAADDVRRVLPLMLTCGMYDFSGQWAFDVGLPAKSGVGGCVFMVIPNVCG
IAVWSPRLDPVGNSVRAVAVAQELCRTYALHNFEVFSGLSRHKVDLSKRRKNEESIKAIA
AVLFAASHGDVRALRSHHIAGMDIYASDYDQRTALHIAAAAGHVDAVEYLGAWPNSADRF
GNTPLSDAIREGHDACKELLTSASKAVAKKSLLERLEESSAAETAETATEAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagtccaccgtctcctctgccttccttgtcaagctgctggaggggtcggggctg
caacgcggtgacgcgcggctcaccgacttctacggcaagctccgcgacctggacgcgctc
gaggtggacaggccactcaccctcgccgtcttcgacaagctcgtggccccctgccgtgac
atcatctacctcgcaatctctggcgacctcagcatccccgacttttccgccttcgggtcg
acgctcgagaaaatctactcgaaaatcaacgagatcaagtctggcgcgaacgcgtcgtac
atcccacagctggcgcaggtgaacccggagcagtttggcatctcggtcaccacggtcagc
ggccagcacctctccatcggagacagcgacgtccccttttgcatccagagctgctccaag
ccgctgagctacttgatggccctcggcgagcacggcagcgcgtacgtgcaccgctgcgtc
ggcacggagccctcgggccagcgcttcaacgagatggtgctcaaggacgcgccggagccg
aagcagccctcgcggcgcatcccgcacaacccgatgatcaacgccggcgccatgatgatg
tgctcgatgctctcgccaaagctcacgcgcgaggagcggctcgaaaaggtgctcgacacg
tggcgcgcgctcaccgccggcgcgggcccggaccccgtcgggtacgacgatgcgacctac
cagtcggagagcgcgaccgccgaccgcaattggtgcctcgcgtacatgatgaaggagagc
ggcgccttcccgccctgcttcacctccctctccgagacgctcgagctctacttccagatt
tgctccattctgtgcacctcgcgcggcatgtcggtcatggccgccacgctcgccaacggt
gggctcaaccccatcacgggcgagcgcgtcttcgccgccgacgatgtgcggcgcgtcctg
ccactcatgctcacgtgcgggatgtacgacttctccggccagtgggcgttcgacgttggc
ttgccggccaagtcgggggtcggcgggtgcgtctttatggtcatccccaacgtgtgcggc
atcgccgtctggtcaccgcggctcgaccccgttggcaactcggtgcgagccgtcgcggtg
gcgcaggagctgtgccgcacctatgcgctgcacaacttcgaggtcttctccggcctctcg
cgccacaaagtcgacctctccaagcggcggaagaacgaggagagcatcaaggcgatcgcg
gcggttctcttcgccgccagccacggcgatgtgcgcgcgctccgcagccaccacattgcc
ggcatggacatctacgcgtcggactatgaccagcgcacggcgctccacatcgccgccgcc
gccgggcacgtggacgcggtcgagtacctcggcgcttggccgaactctgcggatcggttt
gggaataccccgctctccgacgcgatccgcgaggggcatgacgcgtgcaaagagctgctc
acgagcgcgtccaaagcagtggcgaagaagtcgcttctggagcgcttggaggagtccagc
gcggccgagacggccgagacggcaacagaggctgcctga

DBGET integrated database retrieval system