KEGG   Emiliania huxleyi: EMIHUDRAFT_64930Help
Entry
EMIHUDRAFT_64930  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EMIHUDRAFT_64930
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EMIHUDRAFT_64930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin GARS_C
Motif
Other DBs
NCBI-GeneID: 17269626
NCBI-ProteinID: XP_005776509
JGI: Emihu1_64930
UniProt: R1EBP4
Position
Unknown
AA seq 356 aa AA seqDB search
MTIGVVAALVVLSALAAADHRPSAIASKPGALLGLRGGGGDGVTKPLVVVGSLNVDITIE
VERLPKKEETVMASSPCTSVAVGGKGANQAAAAARLATGTGRPAVLVCEFGNDGYAETMR
TALQEAGVDVSRCAHSAELPTGQGIVMLTPDGAASSIVVPGANAGWTAERAAALEELVCG
ASAVLLQREIPEEVNLAVARAACAAGVPVLQDVGGEDRPIDDELLREVAYVCPNETELER
LTGMAIGSEAEILAAGRSLQSRGARNILVTLGGDGSLLLEEGGRVVRQGALPIPGGRVVD
ATGAGDSFRAAFALALTEGQPHEQCMRFAAAAGAVAVAQRGALPSLPTRAQCEEVL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcggcgtcgtcgcggccctcgtcgtgctctccgcgctcgcggcagccgatcac
aggccgagtgcgatcgcgtcaaagcctggcgctcttctgggtctccgtggtggcggtggc
gacggcgttacgaagccgctcgtcgtcgtcggctcgctgaacgtggacatcaccatcgag
gtcgagaggttgccgaagaaggaggagaccgtcatggcgagcagtccgtgcacatcggtc
gcggtcggtggcaagggcgcgaaccaggccgcggccgccgcgcgcctggccactggcacc
ggccggccggcggtgctggtctgtgagtttggcaacgatggctacgccgagacgatgcgg
acggcgctgcaagaagccggcgtcgacgtctcgcgctgcgcgcactccgcggagctgccg
acgggccagggcatcgtgatgctcactcccgacggcgccgcatcgagcatcgtcgtgccc
ggcgccaacgcgggctggacagccgagcgcgcggccgccctggaggagctggtgtgcggc
gcgagcgcggtgctgctgcagcgcgagatcccggaggaggtcaacctggcggtcgcgcgc
gccgcgtgcgccgcgggcgtgccggtgctgcaggacgtgggcggtgaggaccggccgatc
gacgacgagctgctgcgggaggtcgcatatgtgtgcccgaacgagacggagctagagcgg
ctcaccggcatggccatcggcagcgaggcggagatccttgcggccggcaggagcctgcag
tcgcgcggcgcgcgcaacatcctcgtgacgctcggcggcgacggctcgctgctgctggag
gagggcggccgcgtcgtgcggcagggcgcgctgccgatcccgggagggcgcgtcgtcgac
gccaccggcgccggcgactcgttccgcgcggcgttcgcgctcgcgctgaccgagggccag
ccgcacgagcagtgcatgcgcttcgccgccgccgcgggcgccgtcgccgtcgcgcagcgc
ggcgcgctgcccagccttcccacgcgcgcgcagtgcgaggaggtgctg

DBGET integrated database retrieval system