KEGG   Emiliania huxleyi: EMIHUDRAFT_68017Help
Entry
EMIHUDRAFT_68017  CDS       T02915                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EMIHUDRAFT_68017
Peptidases [BR:ehx01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   EMIHUDRAFT_68017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 362 aa AA seqDB search
MASGWCTIESDPGVFSELITELGVKGVQAGVHELWSLDKESMAEVGPVHGLIFLFRWRGE
KDDRATVTPGPGVFFASQMIPNACATQAILSVLMNCPSISLGEEMTAFKAFTKDFPPDVK
GLAISNSDLLRRVHNSFARAEPTVSEERRASKEEDEVYHFISYVPVDGKLYELDGLKAGT
PSLYPLQPPAAWLDAVTPAIQARARALGIEQYSSREIRFNLMAVQARAGKLPSPAELERL
AASHPEPPATGEVAVDERTLEQLLIALAHLTARAAKVAADIENEQQRVGQWKIENIRRRH
NYAPFIVNFLKARPRDAAERRPRRGGGRVPCHASGCEQVLAERGELGPLVEQAKKKQRHG
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggctggtgcacaatagagagcgaccccggcgtcttctcggagctcatcacg
gagctcggcgtcaagggcgtgcaggcgggggtgcatgagctttggtcgctcgacaaggag
tcaatggcggaggtcgggcctgtgcacggtctcattttcctctttcgctggcgcggcgag
aaggacgaccgggccaccgtcactcccgggcccggcgtgtttttcgcctctcagatgatt
ccgaatgcgtgcgcgacccaggccatcctctcggtgctgatgaactgcccgtccatctcg
ctgggcgaggagatgaccgccttcaaggccttcaccaaggacttcccccccgacgtcaaa
gggctcgccatctccaactcggacctgctgcgccgcgtgcacaactcgttcgcaagggcg
gagccgacggtgagcgaggagcggcgggcgagcaaggaggaggacgaggtgtaccacttc
atctcgtacgtgcccgtcgatggcaagctgtacgagctcgacggcctcaaggcgggcaca
ccctcgctgtaccccctccagcctccagctgcttggctcgacgcagtcactcccgccatc
caggcgcgggctcgggctttggggatcgagcagtactcttcgcgcgagatccgattcaac
ttgatggccgtgcaggcgagggccggcaagctgccctcgcctgcggagctcgagcggcta
gccgcctcccacccggagccgcctgccaccggggaggtcgccgtcgacgagcggacgctc
gagcagctcctcatcgcgctcgcccatctgaccgcccgggcggcaaaggtggccgcagac
atcgagaacgagcagcagcgcgtcggccagtggaagatcgaaaacatccgccggcggcac
aactacgcgcccttcatcgtcaacttcctcaaggcgcggccgagagatgcagccgagagg
cggccgagacgcggcggcgggcgtgtgccatgtcacgcgtccggctgcgaacaggtcctc
gccgagcgcggcgagcttgggcccctagtggagcaggcgaagaagaagcagcggcacggg
gctcgctga

DBGET integrated database retrieval system