KEGG   Emiliania huxleyi: EMIHUDRAFT_95998Help
Entry
EMIHUDRAFT_95998  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     EMIHUDRAFT_95998
Protein kinases [BR:ehx01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   EMIHUDRAFT_95998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Ank_2 Ank_5 Ank_4 Ank_3 Ank TPR_19
Motif
Other DBs
NCBI-GeneID: 19046220
NCBI-ProteinID: XP_005770648
JGI: Emihu1_95998
UniProt: R1EBE1
Position
Unknown
AA seq 736 aa AA seqDB search
MSHDSPQTVAAPLHEASSRRSSKLVSTLPKSTLLPSPALEALLGDREDDDTPLTPQQLVQ
LLVDAGHLTRQNVAKERWRTLLQPALRMALPADDPWHSMDVHSLATELAKRWDYNSSTRK
WELSEVMVKLEREPFAEGAMRECYRMKKMSQVSPSFFYRMDWAACNNYVAKRYKKRETGR
GTYFSDIEMQMLSKRLSRHYNALAPPKAVDFLHAFVIEVERGGEQMLFCVERAIERGSYV
KHNNNAGSLDFDGLHRATPNAFSRFTFHASRGELMVVDIQGVDDVHSLKGDDFGDGNLGL
TGLALFFSTSLYDGLCSQLGLPDFALAAAERARVGRLSGSIRCDATKLSSHASSSAGASR
ESCCGEEPAVTAAQLNAAAAAGDVERLRELVGEGKDAGAVNADARSALHLAASEGKLDAV
RFLVEEARAPLVGRDRWGRTPLEEAEAQGHAEATLHRTLERRRSGLAESIGLADLPLELL
AAGEAPPSSPSYSLPPPRASAAPSVLLQPASKAATPLWPRQSSTLLVGASEQREASAPPA
SLGRVHARLAELLLAGGTPTQTEGEADVFSAAYHLVCAAAAGAPHAAREPRALRDLRSML
RGLTGDEVLPGVQLAPLCTEEEQSAAAAACAALGPLLASAGDAAALLDFAEAERAKGELA
GAEEWLRGAVEAVRAGGAFGDAVLHSCLKRLSEVQLERGEAAEAAATLAAAAEAARDAGA
FKLGMKWDMEATAMEE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgactcgccacagaccgtcgccgcgccgctgcacgaggcgtcgtcgcgccgg
tcatccaagctcgtctccacactgccgaaaagcactcttcttccatcgccggcgctcgag
gcgctcctcggcgaccgcgaggacgacgacacgcctctcacgccgcagcaactcgtgcag
ctgctcgtcgacgcggggcacttgacgcgccaaaacgtcgccaaggagcgctggcgcacg
ctgctccagcccgcgctgcggatggcgctgccggccgacgacccttggcacagcatggac
gtgcactccctcgccaccgagctcgccaagcgctgggactacaactcgagtacgcggaag
tgggagctgtccgaggtgatggtcaagttggagagggagcccttcgccgagggcgccatg
cgggagtgctaccgcatgaagaagatgtcgcaggtgtcgccgtccttcttctaccgcatg
gactgggccgcgtgcaacaactacgtcgccaagcggtacaagaagcgcgagacgggccgc
gggacctacttctccgacatcgagatgcagatgctctccaagcgcctctcgcgccactac
aacgccctcgcgcctccaaaggcggtcgacttcctgcacgcgtttgtgatcgaggtggag
cgcggcggcgagcagatgctcttctgtgtcgagcgcgccatcgagcgcggctcctacgtg
aagcacaacaacaacgccggctcgctcgacttcgacggcttgcaccgcgccacgcccaac
gccttctcgcgcttcaccttccacgcctcgcgcggcgagctgatggtggtggacatccag
ggcgtggacgacgtgcactcgctcaagggggacgacttcggcgacggcaacctcggcctc
accggcctcgccctcttcttctccacctcgctctacgacggcctctgcagccagctcggc
ctgcccgacttcgcactcgccgccgccgagcgggcccgcgtgggccggctctcggggtcg
atccggtgcgacgcgaccaagctgtcgagccacgcctcctcctccgccggcgcctcccgc
gagagctgctgcggcgaggagccggcggtcaccgcggcgcagctgaacgccgccgccgcg
gcgggcgacgtcgagcggctgcgcgagctggtgggagagggcaaggacgcgggcgccgtg
aacgccgacgcgaggtcagcgctgcatttggccgccagcgagggcaagctggacgcggtc
cgcttcctggtcgaggaggcgcgcgccccgctggtggggcgggaccggtggggccgcacg
ccgctcgaggaggccgaggcgcaggggcacgcagaggcgacgctgcaccgcactctcgag
cggcgccgcagcggcctggccgagagcatcggcctcgccgacctcccgcttgagctcctc
gcggccggcgaggcgccgccctcttctccctcctactccctccctcccccgcgcgcttcg
gcagccccctccgtgctgctgcagcctgcatcgaaggcagccactcctctgtggccacgg
cagagctccacgctgctcgtcggcgcgtcggagcagcgcgaggcttcggcgccgccggcc
agccttgggagggtgcacgcgcggcttgccgagctgctcctcgccggcggcacgccgacg
cagaccgagggcgaggcggacgtgttttccgccgcctaccacctcgtctgcgccgcggcg
gcaggcgcgccgcacgccgcccgcgagccgcgtgccctccgcgacttgcgctcgatgctg
cgcgggctgacgggcgacgaggtccttcccggggtgcagctcgcaccgctttgcaccgag
gaggagcagtcggccgcggccgcggcgtgcgccgccctcgggccgctcctcgcctcggcg
ggcgacgctgcggctctgctcgacttcgcggaggcggagcgggcgaagggggagctggcc
ggcgcggaggagtggctcaggggcgcagtggaggcggtgcgggcggggggcgcgtttggc
gacgccgtgcttcactcgtgcctcaagcgcctctccgaggtgcagctggagcggggcgag
gcggccgaggcagcggcgactctagcggccgccgccgaggcggcacgcgacgccggcgcc
ttcaagctggggatgaagtgggacatggaggcgacggcgatggaggagtga

DBGET integrated database retrieval system