KEGG   Edwardsiella ictaluri: NT01EI_0109Help
Entry
NT01EI_0109       CDS       T00912                                 

Definition
(GenBank) uroporphyrinogen-III synthase, putative
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00860  Porphyrin and chlorophyll metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
Module
eic_M00121  Heme biosynthesis, glutamate => heme
eic_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01EI_0109
Enzymes [BR:eic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NT01EI_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TIR_2
Motif
Other DBs
NCBI-ProteinID: ACR67364
UniProt: C5BBC9
Position
complement(103894..104640)
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPSPDGEQLVDRLQALGMEAWHTPLINFAPGRQLAQLPEAAAALQRGDLLLAVS
RHAVLHAAESLRQAGREWPTAPRYAAIGHSTAQSLRAACRQPVIFPSAPETSEALLALPA
IQQLQSRRALLLCGNGGRELIANALHARGVSVTLCECYRRVAIAHPGDELYARWRQQKVS
TLVVTSGEMLQQLYDLVPEYDRRRWLLGCRLIVVSERLAQRARDLGWQEIRVAESANNDA
LLRTLQIN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctggtcactcgcccctctcccgacggtgagcagttggtcgaccgcctgcag
gcgctggggatggaggcatggcatacgccgctgatcaactttgcccccggccggcagctg
gcgcaactgccggaggccgcggctgcgctgcagcggggcgatctgctgctggccgtttcc
cgccacgccgttctccacgccgcagaatcgctgcggcaggccggtcgggagtggcccacc
gctccgcgctacgccgctattggccacagcaccgcacagtcgctacgggccgcctgtcgc
caaccggtgatctttccatcggcgccggaaacctcggaggcgcttctggcgctccctgcc
atacaacagctgcagtcccggcgggcgctgctcctgtgcggcaacggcgggcgcgagctg
atcgccaatgccctgcacgcgcgcggcgtatcggtcaccctatgcgaatgctatcgccgg
gtcgccatcgcccaccccggtgacgagctctacgcacgctggcggcaacagaaagtctcg
acactggtagtgaccagtggtgaaatgctgcaacagctctatgatttagttcctgaatac
gatcggcgacgttggctcctcggctgtcggctgatcgtcgtcagcgaacgtctggcacag
cgcgcccgggatctgggatggcaggagatccgggtggcggaaagcgccaacaatgatgcg
ctattgcgtacgctacagatcaactga

DBGET integrated database retrieval system