KEGG   Edwardsiella ictaluri: NT01EI_0121Help
Entry
NT01EI_0121       CDS       T00912                                 

Definition
phospholipase protein family (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT01EI_0121
   00565 Ether lipid metabolism
    NT01EI_0121
   00590 Arachidonic acid metabolism
    NT01EI_0121
   00591 Linoleic acid metabolism
    NT01EI_0121
   00592 alpha-Linolenic acid metabolism
    NT01EI_0121
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NT01EI_0121
    3.1.1.32  phospholipase A1
     NT01EI_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118081..118995
Genome map
AA seq 304 aa AA seqDB search
MSDVVMKELKKQRISGRTWMAAGLVLLPLTAQADGESGATQALQHNEGVIANMLRHYDNP
FTLYPYATNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIAGDNSVLG
AAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGGVHQSNGRA
DPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPSKDDNPDITKYMGYYEAEMGYRLGE
SVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFRQTRFGVGVML
NDIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtggtcatgaaagaattaaaaaaacagaggatttccggtcggacatggatg
gcggccggattggtactgctgccgttgacggcacaggcagatggggagtctggggctacc
caggcattgcagcataacgaaggggtgatcgccaatatgttgcggcattatgataaccca
tttacgctctatccttacgccaccaactatgtgctgtatacccagaccagcgacatcaat
aaagaggccatcagctcttacgactggggcgatcaggctaaaaagaatgagattaaattt
cagattagcctggcatttcctatctggcgcggtatcgccggggataactcggtgctcggc
gcggcctatacccagcagtcctggtggcaggcgtttaaccgcagcgaatcctctccgttt
cgcgaaactaactatgaaccacgcctgtttttaggctgggcgaccgactatcccctgttc
ggcggctgggtgctgcgcgatattgaggcgggtggggtgcaccagtccaatggccgggcg
gatccgacctcgcgcagctggaaccgtgtctatacccgctttctggcgcagaacgggaat
tttcaggttcagctgatgccgtggtatcgcattcctgagagtccgagcaaggacgataac
cccgatatcaccaagtacatgggatactacgaggcagagatgggttaccgtttgggcgag
agcgtcttcagcctgcgtgggcgttacaactggaacagcggctatggcgcggctgagctg
ggttggagctatccgctgacccgccacgtccgcttctatacccagctgttcagtggctat
ggcgagtcgttaatcgactataacttccgccagacccgcttcggcgtcggtgtcatgctg
aacgatatcctgtaa

DBGET integrated database retrieval system