KEGG   Edwardsiella ictaluri: NT01EI_0121Help
Entry
NT01EI_0121       CDS       T00912                                 

Definition
phospholipase protein family (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eic00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:eic00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eic00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:eic00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118081..118995
Genome map
AA seq 304 aa AA seqDB search
MSDVVMKELKKQRISGRTWMAAGLVLLPLTAQADGESGATQALQHNEGVIANMLRHYDNP
FTLYPYATNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIAGDNSVLG
AAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGGVHQSNGRA
DPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPSKDDNPDITKYMGYYEAEMGYRLGE
SVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFRQTRFGVGVML
NDIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtggtcatgaaagaattaaaaaaacagaggatttccggtcggacatggatg
gcggccggattggtactgctgccgttgacggcacaggcagatggggagtctggggctacc
caggcattgcagcataacgaaggggtgatcgccaatatgttgcggcattatgataaccca
tttacgctctatccttacgccaccaactatgtgctgtatacccagaccagcgacatcaat
aaagaggccatcagctcttacgactggggcgatcaggctaaaaagaatgagattaaattt
cagattagcctggcatttcctatctggcgcggtatcgccggggataactcggtgctcggc
gcggcctatacccagcagtcctggtggcaggcgtttaaccgcagcgaatcctctccgttt
cgcgaaactaactatgaaccacgcctgtttttaggctgggcgaccgactatcccctgttc
ggcggctgggtgctgcgcgatattgaggcgggtggggtgcaccagtccaatggccgggcg
gatccgacctcgcgcagctggaaccgtgtctatacccgctttctggcgcagaacgggaat
tttcaggttcagctgatgccgtggtatcgcattcctgagagtccgagcaaggacgataac
cccgatatcaccaagtacatgggatactacgaggcagagatgggttaccgtttgggcgag
agcgtcttcagcctgcgtgggcgttacaactggaacagcggctatggcgcggctgagctg
ggttggagctatccgctgacccgccacgtccgcttctatacccagctgttcagtggctat
ggcgagtcgttaatcgactataacttccgccagacccgcttcggcgtcggtgtcatgctg
aacgatatcctgtaa

DBGET integrated database retrieval system