KEGG   Edwardsiella ictaluri: NT01EI_0147Help
Entry
NT01EI_0147       CDS       T00912                                 

Definition
delta-aminolevulinic acid dehydratase, putative (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eic  Edwardsiella ictaluri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT01EI_0147
Enzymes [BR:eic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NT01EI_0147
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01EI_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144909..145931
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVMEGNNHQEAVSSMPGVQ
RMTIDVLVREAEAIAKLGVPVLSLFPVVGTDKKSLYAEEAYSSDGLVQRAVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAEAGADIVAPSDMMDGR
IGAIRSMLEDQKLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANGDE
ALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMNR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagctatgcatttccaggcgccttcccggggcgtcgcctgcgccgtctgcgccggcat
gattttagtcgccgtctgtgtgccgaaaacgtgctgacggttgacgatctgatctatccg
gtgttcgtcatggaggggaacaaccatcaggaggcggtatcctccatgccgggagttcag
cgcatgaccattgatgtcctggttcgggaagcggaggccatcgctaaactgggcgtgccg
gtgctgtccctgtttccggtggtaggtacggataaaaaatccctgtatgccgaagaggcg
tacagcagcgatggcctggtgcagcgagcggtacgggccttgaaggatgcggtgcctgag
cttggtatcttaaccgatgtcgcgttggatccgtatacgacccacggtcaggatggcgtg
atcgatgaggatggctacgttgttaacgatatcactaaagagatcctggtgcgtcaggcc
ttatcccatgctgaggccggtgccgatatcgtggcaccgagcgatatgatggatggccgg
attggtgctatccgcagcatgctggaggatcaaaaactggtcaacacccagatcatggct
tactccgcgaagtatgcctcctgctactatggtccgttccgcgatgcgctgggctcctct
gggaacctgaagggcggcaacaagaaaacctatcagatggatccggccaacggtgatgag
gcgttgcaggaggtggctcaggatctgcaggagggggccgatatggtgatggttaagccg
ggtatgccgtatctggacgtattacgccgggtgaaagacacctttggcgtgccgaccttt
gcctatcaggtctccggtgagtatgccatgcatatggccgcgatccagaacggttggctg
caggagaagccggcgatcatggagtccctgatttgcttcaagcgtgcgggcgccgatggc
gtgctgacctattttgccaagcgtgtggcgcagtggctgcatgatgcggagatgaatcgc
tga

DBGET integrated database retrieval system