KEGG   Edwardsiella ictaluri: NT01EI_0275Help
Entry
NT01EI_0275       CDS       T00912                                 

Definition
glutaminase, putative (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eic  Edwardsiella ictaluri
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NT01EI_0275
   00330 Arginine and proline metabolism
    NT01EI_0275
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NT01EI_0275
Enzymes [BR:eic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NT01EI_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280260..281186
Genome map
AA seq 308 aa AA seqDB search
MQTELSDQLLGEILEQVRPLLGQGRVADYIPALAGVAPDRLGIAVCTVDGRMFSAGDAAE
RFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQLELEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDSPVARSEFEHSDRNAAIAYLMKSFGN
FDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALDEPVIGERQARQINALMVT
SGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSPQLDSCGNSLAGIAALELLA
QRIGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaattaagtgatcaactgttgggcgagatcctggagcaggttcgtccgctg
ctcgggcaggggcgggtcgccgattatattccggcactggccggggtggcaccagaccgg
ctgggtatcgcggtctgcaccgtagacggacggatgttcagcgctggcgacgccgccgaa
cgcttctctatccagtcgatctccaaggtgctgagcctgacgctggcgatgcaccgctac
agcgaggccgagatctggcagcgggtcggcaaggagccctccgggcagccgtttaactcg
ctggttcagctggagctggagcagggcaagccgcgcaaccccttcatcaacgccggtgcg
ctggtggtgtgtgatatgctgcagtcgcgcctgagcgcaccgcgtcagcgtatgctggag
gtggtgcgggcgctgagtggcagcgcggacatctgctatgattccccggtggcacgctcc
gagtttgaacattcggatcgcaatgcggcgatcgcctatctgatgaagtcgtttggcaac
ttcgataacgacgtgattaccgtcctgcataactatttccactactgcgctttaagaatg
aactgtatggaactggcgcgcacttttgtttatcttgccaatcgggggcgggcgttggcg
ctggatgagccggtgatcggcgagcgtcaggcgcgccagatcaatgcgttgatggtgacc
agcggcctgtatgatggcgcgggcgagtttgcctatcgcgtcgggatgccggggaagtcc
ggcgttggtggcggggtggtggccgtggtgcctcaggagatgatcatcgccgtctggagt
ccgcagctggatagctgcggcaattcactggccggaattgcggcgctggagctgttggcc
cagcgcattggccgctcaatattttaa

DBGET integrated database retrieval system