KEGG   Edwardsiella ictaluri: NT01EI_0460Help
Entry
NT01EI_0460       CDS       T00912                                 

Definition
dihydropteroate synthase, putative (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eic  Edwardsiella ictaluri
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT01EI_0460
Enzymes [BR:eic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NT01EI_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460387..461220
Genome map
AA seq 277 aa AA seqDB search
MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAESMIVAGATIIDVGGE
STRPGAAEVSEAEELARVVPVVEALAQRFEVWVSVDTSKAAVIRACSAAGADMINDVRSL
SEPGALAAAAESGLPICLMHMQGEPKSMQHSPHYSDVVAEVDAYLSAQIERCVAAGIARE
RLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKSMVGQLLNVPPAQRVAGSI
ACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttaggtcacgtgaactcaccctgaatctcaactatccccaggtgatggggatc
ctgaacgtcacccccgactcattctctgacggagggcgtcataatgcgctggatgccgcg
ttgcgacacgcggagtcgatgatcgtcgccggggcgaccattatcgatgtgggcggtgag
tcaactcggccaggtgctgccgaggtgagcgaggcggaagagctggctcgggtggtaccg
gtagtggaggcgctggcgcagcgttttgaggtctgggtctcggtcgatacttccaaggcg
gcggtgatccgcgcctgtagcgccgccggggccgatatgattaacgatgtccgttcgctg
agcgagccgggtgcgctggcggcggcagcggaaagtggcctgccgatctgcctgatgcat
atgcagggtgagccgaagagcatgcagcatagcccccactacagcgatgtggtggcggaa
gtggatgcttacctcagcgcgcagattgaacgttgcgtggctgccgggatcgcccgggag
cgattgttactcgatcccggctttggcttcggtaagaacttgacgcacaattatcgtctt
ctggctaacctggcgcacttccatcaccacggtctgccgctactggtgggaatgtcgcgt
aagtctatggtcgggcagctgctgaatgtgccccccgcgcagcgggtggcaggcagcatc
gcctgtgccgtgatcgccgccatgcagggggcacagattatccgcgtgcacgacgtacgt
gaaacggttgatgccatgcgcgtggtggaagccacgctttcagcaaaggaataa

DBGET integrated database retrieval system